DeepFR - Results    Job ID: 1    Date: 2016-12-29 15:12:46

Query:
Job name: d1a3aa_
Length : 145
Head : >d1a3aa_ d.112.1.1 (A:) Phosphotransferase IIa-mannitol {Escherichia coli [TaxId
Sequence: LFKLGAENIFLGRKAATKEEAIRFAGEQLVKGGYVEPEYVQAMLDREKLTPTYLGESIAVPHGTVEAKDRVLKTGVVFCQ YPEGVRFGEEEDDIARLVIGIAARNNEHIQVITSLTNALDDESVIERLAHTTSVDEVLELLAGRK
INDEX TEMPLATE SCORE FOLD
0d1a3aa_0.88430964d.112.1.1
1d3lf6a_0.86535231d.112.1.1
2d1xiza10.85636536d.112.1.1
3d1a6ja_0.85046960d.112.1.1
4d3oxpa10.84109951d.112.1.0
5d3urra10.83922285d.112.1.0
6d2oqta10.83301912d.112.1.0
7d2a0ja_0.82449927d.112.1.0
8d3bjva_0.82225752d.112.1.0
9d1yb5a10.69920255b.35.1.2
10d1rkna_0.69724457b.40.1.1
11d1x6ma10.68819733b.88.1.4
12d1wura_0.68129495d.96.1.1
13d4xfpa10.68120159d.96.1.4
14d4r8xa10.68100171d.96.1.0
15d1is8a_0.67752304d.96.1.1
16d2j01x10.67637667d.12.1.1
17d1iz0a10.67453619b.35.1.2
18d4ky9a_0.67340588d.112.1.2
19d1vq8s10.67178279d.12.1.1
20d3q62a10.66820566d.38.1.2
21d2qamt10.66624180d.12.1.1
22d2zjrq10.65946085d.12.1.1
23d1y13a_0.65773316d.96.1.2
24d1qora10.65660398b.35.1.2
25d2fcja10.65463347c.136.1.1
26d3lx3a_0.65200627d.96.1.2
27d1a8ra_0.64663291d.96.1.1
28d2o9ma_0.64495342d.96.1.0
29d1oo0a_0.64424726d.232.1.1
30d1vj1a10.64101655b.35.1.2
31d1sqla_0.63930079d.96.1.3
32d1dhna_0.63887618d.96.1.3
33d1nbua_0.63604914d.96.1.3
34d1xn9a_0.63568093d.12.1.3
35d2nnza_0.63341777b.62.1.0
36d5f3ma10.63086026d.96.1.3
37d2hczx10.63084235b.52.1.0
38d4nbia_0.62982768c.110.1.0
39d1ffki_0.62972067d.12.1.2
40d3u3ga_0.62843007c.55.3.0
41d1jj2l_0.62820442d.12.1.2
42d4aeya_0.62674678d.96.1.0
43d1vq8m10.62222932d.12.1.2
44d2g1da10.62143591d.12.1.3
45d3o1ka_0.62129348d.96.1.0
46d1b9la_0.61769290d.96.1.3
47d1zwma10.61675723b.11.1.1
48d4du6a_0.61581104d.96.1.1
49d1vq8k10.61567603b.39.1.1
50d1hpia_0.61266255g.35.1.1
51d4eqpa_0.61221318b.40.1.1
52d2khsa_0.61174873b.40.1.1
53d1ywxa10.61131849d.12.1.3
54d3ubya10.61006331b.46.1.2
55d2phcb10.60836158b.62.1.4
56d1pd0a40.60823644d.109.2.1
57d3e0oa_0.60699209b.88.1.3
58d1snqa_0.60596716b.40.1.1
59d2yzca10.60596182d.96.1.4
60d3r2ea10.60579999d.96.1.0
61d1l1da_0.60526275b.88.1.3
62d1a45a20.60345963b.11.1.1
63d1hp1a10.60331718d.114.1.1
64d1gu7a10.60251227b.35.1.2
65d1tt7a10.60212939b.35.1.2
66d1n10a20.60182156b.52.1.3
67d1w74a_0.59994463b.62.1.1
68d1xa0a10.59921704b.35.1.2
69d3guva_0.59856571c.53.1.0
70d1b24a20.59835722d.95.2.1
71d2zjrh10.59802900b.39.1.1
72d3hz2a_0.59766310b.11.1.0
73d1woqa20.59682924c.55.1.10
74d2v94a10.59631248d.12.1.3
75d2qamk10.59604993b.39.1.1
76d3a6ra_0.59563005b.45.1.1
77d2ciwa10.59496059a.39.3.1
78d2m00a_0.59465185b.40.1.1
79d1o89a10.59428576b.35.1.2
80d2dm6a10.59377198b.35.1.2
81d1mkaa_0.59353541d.38.1.2
82d1r7ma20.59326244d.95.2.1
83d4b0ba_0.59210876d.38.1.2
84d1zc6a20.59207606c.55.1.5
85d1g31a_0.59121459b.35.1.1
86d1zwma20.59065737b.11.1.1
87d3l8wa10.59039659d.96.1.0
88d1m8ua20.59001715b.11.1.1
89d3p3ka10.59000905b.88.1.2
90d1wkaa_0.58978890b.51.1.1
91d3hmsa_0.58972042g.10.1.1
92d2okva_0.58900881c.110.1.0
93d2a29a_0.58896063d.220.1.1
94d2za4b_0.58884028c.9.1.1
95d1b0ya_0.58857685g.35.1.1
96d2v2ua20.58831511b.11.1.0
97d1gmnb10.58773598g.10.1.1
98d1v95a10.58718464c.51.1.1
99d1ytqa20.58698218b.11.1.1