TreeThreader - Results

  Job information

Job ID: test_new
#Proteins: 1
Protein ID: test_new_1
Fasta ID: test_new_1
Submission time: 2018-09-27 15:13:26 +0800
Finished time: 2018-09-27 15:13:26 +0800
Identical Job(s): hemoglobin_3 26342_1 26348_1

  Alignments

1
50
100
150
200
207

  Top 10 hits

Query:
Job ID  : test_new_1
Length : 207
Sequence: MLRYLSRPLVHAARTTTAGAHAQPPLALRRLSSRSIGRSVAGRQGGGGSTGQVMPRGQSGPPLASLGRFFDDFGMDVFND PFFRPFLARGPGSSLEAADVSMGLDIAETDKEYVVKAELPGVKKEDIKVTFQEGILNIAAERKCEEVKEDERTQRHYSDF AYGKVSRSLRVPDAAEKDQVDAHLEDGVLTVKIAKGEHSKPKEIEVK

No Hit MAC Score Identity Cols Query HMM Template HMM

  Pairwise Query-Template Alignment