TreeThreader - Results

  Job information

Job ID: test
#Proteins: 1
Protein ID: test
Fasta ID: scaffold00007.g10
Submission time: 2014-08-25 15:55:46 +0800
Finished time: 2014-08-25 16:10:59 +0800
Identical Job(s): hemoglobin_3 26342_1 26348_1

  Alignments

1
50
100
150
200
207

  Top 10 hits

Query:
Job ID  : test
Length : 207
Sequence: MLRYLSRPLVHAARTTTAGAHAQPPLALRRLSSRSIGRSVAGRQGGGGSTGQVMPRGQSGPPLASLGRFFDDFGMDVFND PFFRPFLARGPGSSLEAADVSMGLDIAETDKEYVVKAELPGVKKEDIKVTFQEGILNIAAERKCEEVKEDERTQRHYSDF AYGKVSRSLRVPDAAEKDQVDAHLEDGVLTVKIAKGEHSKPKEIEVK

No Hit MAC Score Identity Cols Query HMM Template HMM

  Pairwise Query-Template Alignment