TreeThreader - Results

  Job information

Job ID: hemoglobin
#Proteins: 6
Protein ID: hemoglobin_3
Fasta ID: hemoglobin_3
Submission time: 2015-09-14 23:06:14 +0800
Finished time: 2015-09-14 23:06:15 +0800
Identical Job(s): test hemoglobin_1 hemoglobin_4 26341_1 26342_1 26343_1 26345_1 26348_1 39884_1 test_new_1

  Alignments

1
50
100
150
200
207
3GT6_A 3GT6_A 1SHS_A 1SHS_A 3GLA_A 3GLA_A 1GME_A 1GME_A 2BYU_A 2BYU_A 3N3E_A 3N3E_A 2H50_A 2H50_A 3L1E_A 3L1E_A 3L1F_A 3L1F_A 2WJ7_A 2WJ7_A

  Build multi-template model (choose up to 5 templates)

                   
Download full-length structure

  Top 10 hits

Query:
Job ID  : hemoglobin_3
Length : 207
Sequence: MLRYLSRPLVHAARTTTAGAHAQPPLALRRLSSRSIGRSVAGRQGGGGSTGQVMPRGQSGPPLASLGRFFDDFGMDVFND PFFRPFLARGPGSSLEAADVSMGLDIAETDKEYVVKAELPGVKKEDIKVTFQEGILNIAAERKCEEVKEDERTQRHYSDF AYGKVSRSLRVPDAAEKDQVDAHLEDGVLTVKIAKGEHSKPKEIEVK

No Hit MAC Score Identity Cols Query HMM Template HMM
13GT6_A83.40.3310395-1991-103
21SHS_A800.3112681-2071-147
33GLA_A79.70.3310098-1991-100
41GME_A77.930.321481-2071-150
52BYU_A72.370.35101101-2021-101
63N3E_A70.20.1497102-2071-102
72H50_A68.290.3993102-1951-93
83L1E_A65.720.1899100-2071-105
93L1F_A63.690.1996103-2071-102
102WJ7_A61.960.1893102-2041-94

  Pairwise Query-Template Alignment

No 1
> 3GT6_A        Alignment in PIR format
MAC score = 83.4	Identity = 0.33

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCEECEEECCCEEEEEEECCCCCCCCEEEEEECCEEEEEEEEECEEEEECCCEEEEEEEEEEEEEEEEEECCCC80 (105)
Q hemoglobin_31LEAADVSMGLDIAETDKEYVVKAELPGVKKEDIKVTFQEGILNIAAERKCEEVKEDERTQRHYSDFAYGKVSRSLRVPDA80 (105)
T 3GT6_A1VVTAQWVPRVDIKEEVNHFVLYADLPGIDPSQIEVQMDKGILSIRGERKSESSTETE--RFSRIERRYGSFHRRFALPDS80 (105)
T ss_pred1CCCCCCCCCEEEEECCCEEEEEEECCCCCHHHEEEEEECCEEEEEEEECCCCCCCCC--CEEEEEEECCEEEEEEECCCC80 (105)
T ss_dssp1UUCCSSCCCEEEEECSSEEEEEEECTTSCGGGCEEEEETTEEEEEEEECCGGGSSGG--GEEEECCCCEEEEEEEECCTT80 (105)
Q ss_pred81CCCCCCEEEECCCEEEEEEECCCCC105 (105)
Q hemoglobin_381AEKDQVDAHLEDGVLTVKIAKGEHS105 (105)
T 3GT6_A81ADADGITAAGRNGVLEIRIPKRPAA105 (105)
T ss_pred81CCHHHEEEEEECCEEEEEEECCCCC105 (105)
T ss_dssp81BCTTSCEEEEETTEEEEEEEBCCCU105 (105)


No 2
> 1SHS_A        Alignment in PIR format
MAC score = 80	Identity = 0.31

Download partial structureDownload full-length structure
Q ss_pred1CCCC-CCC--C-C-CC----------------CCCCCCCCCCCEECEEECCCEEEEEEECCCCCCCCEEEEEECCEEEEE80 (148)
Q hemoglobin_31PFFR-PFL--A-R-GP----------------GSSLEAADVSMGLDIAETDKEYVVKAELPGVKKEDIKVTFQEGILNIA80 (148)
T 1SHS_A1MFGRDPFDSLFERMFKEFFATPMTGTTMIQSSTGIQISGKGFMPISIIEGDQHIKVIAWLPGVNKEDIILNAVGDTLEIR80 (148)
T ss_pred1CCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEEECCCEEEEEEEECCCCHHHEEEEEECCEEEEE80 (148)
T ss_dssp1UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUCCCEEEEESCCCEEEEECSSEEEEEEECTTCCGGGEEEEEETTEEEEE80 (148)
Q ss_pred81EEEECEEEEECCCEEEEEEEEEEEEEEEEEECCCCCCCCCCEEEECCCEEEEEEECCCCCCCCEEECC148 (148)
Q hemoglobin_381AERKCEEVKEDERTQRHYSDFAYGKVSRSLRVPDAAEKDQVDAHLEDGVLTVKIAKGEHSKPKEIEVK148 (148)
T 1SHS_A81AKRSPLMITESER-IIYSEIPEEEEIYRTIKLPATVKEENASAKFENGVLSVILPKAESSIKKGINIE148 (148)
T ss_pred81EEECCCCCCCCCC-EEEEEEEECCEEEEEEECCCCCCHHHEEEEEECCEEEEEEECCCCCCCCEECCC148 (148)
T ss_dssp81EECCCCCCCTTCE-EEEECSCCCCEEEEEEECSSCBCGGGCEEEEETTEEEEEEEBCGGGCCEECCCC148 (148)


No 3
> 3GLA_A    Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A     Alignment in PIR format
MAC score = 79.7	Identity = 0.33

Download partial structureDownload full-length structure
Q ss_pred1CCCCCEECEEECCCEEEEEEECCCCCCCCEEEEEECCEEEEEEEEECEEEEECCCEEEEEEEEEEEEEEEEEECCCCCCC80 (102)
Q hemoglobin_31ADVSMGLDIAETDKEYVVKAELPGVKKEDIKVTFQEGILNIAAERKCEEVKEDERTQRHYSDFAYGKVSRSLRVPDAAEK80 (102)
T 3GLA_A1AQWVPRVDIKEEVNHFVLYADLPGIDPSQIEVQMDKGILSIRGERKSESSTE--TERFSRIERRYGSFHRRFALPDSADA80 (102)
T ss_pred1CCCCCCEEEEECCCEEEEEEECCCCCHHHEEEEEECCEEEEEEEECCCCCCC--CCEEEEEEECCCEEEEEEECCCCCCC80 (102)
T ss_dssp1CCSCCCEEEEECSSEEEEEEECTTSCGGGCEEEEETTEEEEEEEECCGGGSS--GGGEEEECCCCEEEEEEEECCTTBCT80 (102)
Q ss_pred81CCCEEEECCCEEEEEEECCCCC102 (102)
Q hemoglobin_381DQVDAHLEDGVLTVKIAKGEHS102 (102)
T 3GLA_A81DGITAAGRNGVLEIRIPKRPAA102 (102)
T ss_pred81CCCEEEEECCEEEEEEECCCCC102 (102)
T ss_dssp81TSCEEEEETTEEEEEEEBCUUU102 (102)


No 4
> 1GME_A    Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A     Alignment in PIR format
MAC score = 77.93	Identity = 0.32

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCHHHHHHHCCCCCCCCCCHHHCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC80 (209)
Q hemoglobin_31MLRYLSRPLVHAARTTTAGAHAQPPLALRRLSSRSIGRSVAGRQGGGGSTGQVMPRGQSGPPLASLGRFFDDFGMDVFND80 (209)
T 1GME_A1MSIVRRSNVF----D-PFADLWADPFDTF--------RS-----------------------------------------80 (209)
T ss_pred1CCEECCCCCC----C-CHHHHHCCCCHHH--------HH-----------------------------------------80 (209)
T ss_dssp1UCCCCSCCCB----C-TTCGGGSSHHHHH--------HH-----------------------------------------80 (209)
Q ss_pred81CCCCCCCCCCCCCCCCCCCCCCEECEEECCCEEEEEEECCCCCCCCEEEEEECCEEEEEEEEECEEEEECCCEEEEEEEE160 (209)
Q hemoglobin_381PFFRPFLARGPGSSLEAADVSMGLDIAETDKEYVVKAELPGVKKEDIKVTFQEGILNIAAERKCEEVKEDERTQRHYSDF160 (209)
T 1GME_A81----IVPAISGGGSETAAFANARMDWKETPEAHVFKADLPGVKKEEVKVEVEDGNVLVVSGER-TKEKEDKNDKWHRVER160 (209)
T ss_pred81----HCCCCCCCCCCCCCCCCCCEEEEECCCEEEEEEECCCCCHHHEEEEEECCCEEEEEEEE-CCCCCCCCCCEEEEEE160 (209)
T ss_dssp81----HGGGTTSSCCSHHHHGGGCEEEEECSSEEEEEEECTTCCGGGEEEEEETTTEEEEEECC-CCCCCCTTCEEEECCC160 (209)
Q ss_pred161EEEEEEEEEECCCCCCCCCCEEEECCCEEEEEEECCCCCCCC--EEECC209 (209)
Q hemoglobin_3161AYGKVSRSLRVPDAAEKDQVDAHLEDGVLTVKIAKGEHSKPK--EIEVK209 (209)
T 1GME_A161SSGKFVRRFRLLEDAKVEEVKAGLENGVLTVTVPKAEVKKPEVKAIQIS209 (209)
T ss_pred161CCCEEEEEEECCCCCCHHHEEEEEECCEEEEEEECCCCCCCCCEEEECC209 (209)
T ss_dssp161CCCCEEEEEECSSCCCGGGCEEEEETTEEEEEEECCCCCTTCCCCCCCC209 (209)


No 5
> 2BYU_A        Alignment in PIR format
MAC score = 72.37	Identity = 0.35

Download partial structureDownload full-length structure
Q ss_pred1CCEECEEECCCEEEEEEECCCCCCCCEEEEEECCEEEEEEEEECEEEEECCCEEEEEEEEEEEEEEEEEECCCCCCCCCC80 (102)
Q hemoglobin_31SMGLDIAETDKEYVVKAELPGVKKEDIKVTFQEGILNIAAERKCEEVKEDERTQRHYSDFAYGKVSRSLRVPDAAEKDQV80 (102)
T 2BYU_A1NARMDWKETPEAHVFKADLPGVKKEEVKVEVEDGNVLVVSGERTK-EKEDKNDKWHRVERSSGKFVRRFRLLEDAKVEEV80 (102)
T ss_pred1CCCEEEEECCCEEEEEEEECCCCHHHEEEEEECCCEEEEEEEECC-CCCCCCCCEEEEEEEEEEEEEEEECCCCCCHHHE80 (102)
T ss_dssp1CCCEEEEECSSEEEEEEECTTCCGGGEEEEEETTTEEEEEECCCC-CCCCTTCEEEECCCCCCCEEEEEECSSCCCGGGC80 (102)
Q ss_pred81EEEECCCEEEEEEECCCCCCCC102 (102)
Q hemoglobin_381DAHLEDGVLTVKIAKGEHSKPK102 (102)
T 2BYU_A81KAGLENGVLTVTVPKAAIQISG102 (102)
T ss_pred81EEEEECCEEEEEEECCCCCCCC102 (102)
T ss_dssp81EEEEETTEEEEEEECCCBCEEC102 (102)


No 6
> 3N3E_A        Alignment in PIR format
MAC score = 70.2	Identity = 0.14

Download partial structureDownload full-length structure
Q ss_pred1CEECEEECCCEEEEEEECCCCCCCCEEEEEECCEEEEEEEEECEEEEECCCEEEEEEEEEEEEEEEEEECCCCCCCCCCE80 (111)
Q hemoglobin_31MGLDIAETDKEYVVKAELPGVKKEDIKVTFQEGILNIAAERKCEEVKEDERTQRHYSDFAYGKVSRSLRVPDAAEKDQVD80 (111)
T 3N3E_A1GVSEVRSDREKFTVYLDVKHFSPDELSVKVTDDYVEIQGKHGERQDDH----G-----YISREFHRRYRLPSNVDQSAIT80 (111)
T ss_pred1CCCEEEECCCEEEEEEECCCCCHHHEEEEEECCEEEEEEEEEEEECCC----C-----EEEEEEEEEEECCCCCCHHHEE80 (111)
T ss_dssp1CCEEEEECSSEEEEEEECTTCCGGGEEEEEETTEEEEEEEEEEEETTT----E-----EEEEEEEEEEECCTTBCGGGCE80 (111)
Q ss_pred81EEEC-CCEEEEEEECCCCC----CCCEEECC111 (111)
Q hemoglobin_381AHLE-DGVLTVKIAKGEHS----KPKEIEVK111 (111)
T 3N3E_A81CTLSADGLLTLCGPKTSGIDAGRGDRTIPVT111 (111)
T ss_pred81EEECCCCEEEEEEECCCCCCCCCCCEEEEEE111 (111)
T ss_dssp81EEECTTSEEEEEEEBCCSSCCCCCCEEECEE111 (111)


No 7
> 2H50_A        Alignment in PIR format
MAC score = 68.29	Identity = 0.39

Download partial structureDownload full-length structure
Q ss_pred1CEECEEECCCEEEEEEECCCCCCCCEEEEEECCEEEEEEEEECEEEEECCCEEEEEEEEEEEEEEEEEECCCCCCCCCCE80 (94)
Q hemoglobin_31MGLDIAETDKEYVVKAELPGVKKEDIKVTFQEGILNIAAERKCEEVKEDERTQRHYSDFAYGKVSRSLRVPDAAEKDQVD80 (94)
T 2H50_A1ARMDWKETPEAHVFKADLPGVKKEEVKVEVEDGNVLVVSGERTKE-KEDKNDKWHRVERSSGKFVRRFRLLEDAKVEEVK80 (94)
T ss_pred1CCCEEEECCCEEEEEEEECCCCHHHEEEEEECCCEEEEEEEECCC-CCCCCCCEEEEEEEEEEEEEEEECCCCCCHHHEE80 (94)
T ss_dssp1CCEEEEECSSEEEEEEECTTCCGGGEEEEEETTTEEEEEECCCCC-CCCTTCEEEECCCCCCCEEEEEECSSCCCGGGCE80 (94)
Q ss_pred81EEECCCEEEEEEEC94 (94)
Q hemoglobin_381AHLEDGVLTVKIAK94 (94)
T 2H50_A81AGLENGVLTVTVPK94 (94)
T ss_pred81EEEECCEEEEEEEC94 (94)
T ss_dssp81EEEETTEEEEEEEC94 (94)


No 8
> 3L1E_A    Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A     Alignment in PIR format
MAC score = 65.72	Identity = 0.18

Download partial structureDownload full-length structure
Q ss_pred1CCCEECEEECCCEEEEEEECCCCCCCCEEEEEECCEEEEEEEEECEEEEECCCEEEEEEEEEEEEEEEEEECCCCCCCCC80 (114)
Q hemoglobin_31VSMGLDIAETDKEYVVKAELPGVKKEDIKVTFQEGILNIAAERKCEEVKEDERTQRHYSDFAYGKVSRSLRVPDAAEKDQ80 (114)
T 3L1E_A1GSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQEDFVEIHGKHNERQDD----HG-----YISREFHRRYRLPSNVDQSA80 (114)
T ss_pred1CCCCEEEEECCCEEEEEEECCCCCHHHEEEEEECCEEEEEEEEECCCCC----CC-----EEEEEEEEEEECCCCCCHHH80 (114)
T ss_dssp1UCCSEEEEECSSEEEEEEECTTSCGGGEEEEEETTEEEEEEEEEEEETT----TE-----EEEEEEEEEEECCTTBCTTS80 (114)
Q ss_pred81CEEE-ECCCEEEEEEECCCCCCC-----CEEECC114 (114)
Q hemoglobin_381VDAH-LEDGVLTVKIAKGEHSKP-----KEIEVK114 (114)
T 3L1E_A81LSCSLSADGMLTFSGPKIPSGVDAGHSERAIPVS114 (114)
T ss_pred81CEEEECCCCEEEEEEECCCCCCCCCCCCEEEEEC114 (114)
T ss_dssp81CEEEECTTSEEEEEEEBCCCCTTTTSSSCCCCCC114 (114)


No 9
> 3L1F_A        Alignment in PIR format
MAC score = 63.69	Identity = 0.19

Download partial structureDownload full-length structure
Q ss_pred1EECEEECCCEEEEEEECCCCCCCCEEEEEECCEEEEEEEEECEEEEECCCEEEEEEEEEEEEEEEEEECCCCCCCCCCEE80 (111)
Q hemoglobin_31GLDIAETDKEYVVKAELPGVKKEDIKVTFQEGILNIAAERKCEEVKEDERTQRHYSDFAYGKVSRSLRVPDAAEKDQVDA80 (111)
T 3L1F_A1GSEVRSDRDKFVIFLDVKHFSPEDLTVKVQEDFVEIHGKHNERQDD---HGYI------SREFHRRYRLPSNVDQSALSC80 (111)
T ss_pred1CCEEEECCCEEEEEEECCCCCHHHEEEEEECCEEEEEEEEEEECCC---CCEE------EEEEEEEEECCCCCCHHHEEE80 (111)
T ss_dssp1UCEEEECSSEEEEEEECTTCCGGGEEEEEETTEEEEEEEEEEECGG---GCEE------EEEEEEEEECCTTBCTTSCEE80 (111)
Q ss_pred81E-ECCCEEEEEEECCCCCCC-----CEEECC111 (111)
Q hemoglobin_381H-LEDGVLTVKIAKGEHSKP-----KEIEVK111 (111)
T 3L1F_A81SLSADGMLTFSGPKIPSGVDAGHSERAIPVS111 (111)
T ss_pred81EECCCCEEEEEECCCCCCCCCCCCCEEEEEE111 (111)
T ss_dssp81EECTTSEEEEEEEBCCCCCUUUUUCCCCCCC111 (111)


No 10
> 2WJ7_A        Alignment in PIR format
MAC score = 61.96	Identity = 0.18

Download partial structureDownload full-length structure
Q ss_pred1CEECEEECCCEEEEEEECCCCCCCCEEEEEECCEEEEEEEEECEEEEECCCEEEEEEEEEEEEEEEEEECCCCCCCCCCE80 (104)
Q hemoglobin_31MGLDIAETDKEYVVKAELPGVKKEDIKVTFQEGILNIAAERKCEEVKEDERTQRHYSDFAYGKVSRSLRVPDAAEKDQVD80 (104)
T 2WJ7_A1GAMEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQ--DE-HG------FISREFHRKYRIPADVDPLTIT80 (104)
T ss_pred1CEEEEEECCCEEEEEEEECCCCHHHEEEEEECCEEEEEEEEEEEC--CC-CC------EEEEEEEEEEECCCCCCHHHEE80 (104)
T ss_dssp1UUCCEEECSSEEEEEEECTTSCGGGEEEEEETTEEEEEEEECCCB--CS-SS------EEEEEEEEEEECCTTCCGGGCE80 (104)
Q ss_pred81EE-ECCCEEEEEEECCCCCCCCEE104 (104)
Q hemoglobin_381AH-LEDGVLTVKIAKGEHSKPKEI104 (104)
T 2WJ7_A81SSLSSDGVLTVNGPRKQVSGP-ER104 (104)
T ss_pred81EEECCCCEEEEEECCCCCCCC-CC104 (104)
T ss_dssp81EEECTTSEEEEEEECCUUUUU-UU104 (104)