TreeThreader - Results

  Job information

Job ID: d20181203
#Proteins: 4
Protein ID: d20181203_2
Fasta ID: seq2
Submission time: 2018-12-03 10:54:03 +0800
Finished time: 2019-02-17 23:04:04 +0800
Identical Job(s): NULL

  Alignments

1
50
100
150
200
250
300
350
377
2H3W_A 2H3W_A 1T7N_A 1T7N_A 1NDB_A 1NDB_A 2H3P_A 2H3P_A 1NM8_A 1NM8_A 1T7Q_A 1T7Q_A 1T1U_A 1T1U_A 1Q6X_A 1Q6X_A 2FY5_A 2FY5_A 1XMD_A 1XMD_A

  Build multi-template model (choose up to 5 templates)

                   
Download full-length structure

  Top 10 hits

Query:
Job ID  : d20181203_2
Length : 377
Sequence: VHTWQLPVLPVPAYQHQSHTYLHAARPLVSGYTWAHTCQYVIEFQNSGGVGEGLDKGHEREARMTVSTLSEWALKTIWMQ YRQPVVIYSSPGVMLPWQDFVDLRGVLRFAAPLPSTVLDEKPMISNITIPVEYLGGKNLITLQCYQENSSCRVPGPNQNT NSGFRKIRKPPTIIEVVHNYQFFISILYHSDATPLTEGQIFVQIEKIWNSSLQTNKEPVMPLSSNHRNSFYKAMDLLIKK KVNRDSVRSRSKSAFTKCLDATMPRVAHDVYRSHTACQMLHWGGHRHNIGDREFVKQLQLIVQEIGSLGLFYEHAAAEGP PIVTCYLYVIEYTKKPELMFSPLVPLHMPKKLKFNITGEIKFDIEKLKQNTNHAILD

No Hit MAC Score Identity Cols Query HMM Template HMM
12H3W_A295.660.633771-3774-380
21T7N_A295.470.633771-37722-398
31NDB_A295.30.633771-3771-377
42H3P_A295.280.633771-3774-380
51NM8_A293.640.693771-3779-385
61T7Q_A293.130.633771-37722-398
71T1U_A255.450.283731-37717-399
81Q6X_A254.840.283731-37718-400
92FY5_A245.110.313731-3778-387
101XMD_A224.680.223681-37715-393

  Pairwise Query-Template Alignment

No 1
> 2H3W_A        Alignment in PIR format
MAC score = 295.66	Identity = 0.63

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCHHHHHHHCCCCCC80 (377)
Q d20181203_21VHTWQLPVLPVPAYQHQSHTYLHAARPLVSGYTWAHTCQYVIEFQNSGGVGEGLDKGHEREARMTVSTLSEWALKTIWMQ80 (377)
T 2H3W_A1AHQDALPRLPVPPLQQSLDYYLKALQPIVSEEEWAHTKQLVDEFQTSGGVGERLQKGLERRAKKMENWLSEWWLKTAYLQ80 (377)
T ss_pred1CCCHHCCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHCC80 (377)
T ss_dssp1HHHHTSCCCCCCCHHHHHHHHHHHHTTTSCHHHHHHHHHHHHHHTSTTSHHHHHHHHHHHHHHSSSCSSHHHHHHHHTTT80 (377)
Q ss_pred81CCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHCCCCCCCCHHHHHHHCCCCCCCCCCCC160 (377)
Q d20181203_281YRQPVVIYSSPGVMLPWQDFVDLRGVLRFAAPLPSTVLDEKPMISNITIPVEYLGGKNLITLQCYQENSSCRVPGPNQNT160 (377)
T 2H3W_A81FRQPVVIYSSPGVILPKQDFVDLQGQLRFAAKLIEGVLDFKSMIDNETLPVEFLGGQPLCMNQYYQILSSCRVPGPKQDS160 (377)
T ss_pred81CCCCCCCCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCEECCHHHHHHHHHCCCCCCCCCCE160 (377)
T ss_dssp81CCSCSBTTTBCEEECCCCCCCSHHHHHHHHHHHHHHHHHHHHHHHTTCCCCCEETTEECCCGGGGTSSSEEEECCSSSCE160 (377)
Q ss_pred161CCCCCCCCCCCCEEEEEECCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEECCCCCCCHHHHHHHHHHHC240 (377)
Q d20181203_2161NSGFRKIRKPPTIIEVVHNYQFFISILYHSDATPLTEGQIFVQIEKIWNSSLQTNKEPVMPLSSNHRNSFYKAMDLLIKK240 (377)
T 2H3W_A161VVNFLKSKRPPTHITVVHNYQFFELDVYHSDGTPLTSDQIFVQLEKIWNSSLQSNKEPVGILTSNHRNTWAKAYNNLIKD240 (377)
T ss_pred161EEECCCCCCCCCEEEEEECCEEEEEEEECCCCEECCHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCHHHHHHHHHHHC240 (377)
T ss_dssp161EEECTTSSSCCCEEEEEETTEEEEEECBCSSSCBCCHHHHHHHHHHHHHTTCSCCSCCGGGGGGSCHHHHHHHHHHHTTS240 (377)
Q ss_pred241CCCHHHHHHHHHEEEEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCH320 (377)
Q d20181203_2241KVNRDSVRSRSKSAFTKCLDATMPRVAHDVYRSHTACQMLHWGGHRHNIGDREFVKQLQLIVQEIGSLGLFYEHAAAEGP320 (377)
T 2H3W_A241KVNRESVNSIQKSIFTVCLDKQVPRVSDDVYRNHVAGQMLHGGGSKFNSGNRWFDKTLQFIVAEDGSCGMVYEHAAAEGP320 (377)
T ss_pred241CCCHHHHHHHHHEEEEEEECCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEECCCCCEEEEEECCCCCHH320 (377)
T ss_dssp241HHHHHHHHHHHHSSCEEEECCCCCCCCTTTHHHHHHHHHHTCSCTTTTTTSCCTTBSEEEEECTTSCEEEEECTTTCCHH320 (377)
Q ss_pred321HHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHCC377 (377)
Q d20181203_2321PIVTCYLYVIEYTKKPELMFSPLVPLHMPKKLKFNITGEIKFDIEKLKQNTNHAILD377 (377)
T 2H3W_A321PIVALVDHVMEYTKKPELVRSPMVPLPMPKKLRFNITPEIKNDIEKAKQNLSIMIQD377 (377)
T ss_pred321HHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHC377 (377)
T ss_dssp321HHHHHHHHHHHHHTSCCCCCCCCCCCCCCEEECCCCCHHHHHHHHHHHHHHHHHHHH377 (377)


No 2
> 1T7N_A        Alignment in PIR format
MAC score = 295.47	Identity = 0.63

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCHHHHHHHCCCCCC80 (377)
Q d20181203_21VHTWQLPVLPVPAYQHQSHTYLHAARPLVSGYTWAHTCQYVIEFQNSGGVGEGLDKGHEREARMTVSTLSEWALKTIWMQ80 (377)
T 1T7N_A1AHQDALPRLPVPPLQQSLDYYLKALQPIVSEEEWAHTKQLVDEFQTSGGVGERLQKGLERRAKKMENWLSEWWLKTAYLQ80 (377)
T ss_pred1CCHHHCCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCCCCHHHHHHHHCC80 (377)
T ss_dssp1HHHHTSCCCCCCCHHHHHHHHHHHHGGGSCHHHHHHHHHHHHHHTSTTSHHHHHHHHHHHHHHHSSCSSHHHHHHHHTTT80 (377)
Q ss_pred81CCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHCCCCCCCCHHHHHHHCCCCCCCCCCCC160 (377)
Q d20181203_281YRQPVVIYSSPGVMLPWQDFVDLRGVLRFAAPLPSTVLDEKPMISNITIPVEYLGGKNLITLQCYQENSSCRVPGPNQNT160 (377)
T 1T7N_A81FRQPVVIYSSPGVILPKQDFVDLQGQLRFAAKLIEGVLDFKSMIDNETLPVEFLGGQPLCMNQYYQILSSCRVPGPKQDS160 (377)
T ss_pred81CCCCCCCCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCEECCHHHHHHHHHCCCCCCCCCCE160 (377)
T ss_dssp81CCSCSBTTTBCEEECCCCCCCSHHHHHHHHHHHHHHHHHHHHHHHTTCSCCEEETTEEECCGGGGSSSSEEEECCSSSCE160 (377)
Q ss_pred161CCCCCCCCCCCCEEEEEECCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEECCCCCCCHHHHHHHHHHHC240 (377)
Q d20181203_2161NSGFRKIRKPPTIIEVVHNYQFFISILYHSDATPLTEGQIFVQIEKIWNSSLQTNKEPVMPLSSNHRNSFYKAMDLLIKK240 (377)
T 1T7N_A161VVNFLKSKRPPTHITVVHNYQFFELDVYHSDGTPLTSDQIFVQLEKIWNSSLQSNKEPVGILTSNHRNTWAKAYNNLIKD240 (377)
T ss_pred161EEECCCCCCCCCEEEEEECCEEEEEEEECCCCEECCHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCHHHHHHHHHHHC240 (377)
T ss_dssp161EEECTTSSSCCCEEEEEETTEEEEEECBCTTSCBCCHHHHHHHHHHHHHHTCSCCSCCGGGGGGSCHHHHHHHHHHHTTS240 (377)
Q ss_pred241CCCHHHHHHHHHEEEEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCH320 (377)
Q d20181203_2241KVNRDSVRSRSKSAFTKCLDATMPRVAHDVYRSHTACQMLHWGGHRHNIGDREFVKQLQLIVQEIGSLGLFYEHAAAEGP320 (377)
T 1T7N_A241KVNRESVNSIQKSIFTVCLDKQVPRVSDDVYRNHVAGQMLHGGGSKFNSGNRWFDKTLQFIVAEDGSCGMVYEHAAAEGP320 (377)
T ss_pred241CCCHHHHHHHHHEEEEEEECCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEECCCCCEEEEEECCCCCHH320 (377)
T ss_dssp241HHHHHHHHHHHHSSCEEEECCCCCCCCGGGHHHHHHHHHHTCSCTTTTTTSCCTTBSEEEEECTTSCEEEEECTTTCCHH320 (377)
Q ss_pred321HHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHCC377 (377)
Q d20181203_2321PIVTCYLYVIEYTKKPELMFSPLVPLHMPKKLKFNITGEIKFDIEKLKQNTNHAILD377 (377)
T 1T7N_A321PIVALVDHVMEYTKKPELVRSPMVPLPMPKKLRFNITPEIKNDIEKAKQNLSIMIQD377 (377)
T ss_pred321HHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHC377 (377)
T ss_dssp321HHHHHHHHHHHHTTSCCCCCCCCCCCCCCEEECCCCCHHHHHHHHHHHHHHHHHHHH377 (377)


No 3
> 1NDB_A        Alignment in PIR format
MAC score = 295.3	Identity = 0.63

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCHHHHHHHCCCCCC80 (377)
Q d20181203_21VHTWQLPVLPVPAYQHQSHTYLHAARPLVSGYTWAHTCQYVIEFQNSGGVGEGLDKGHEREARMTVSTLSEWALKTIWMQ80 (377)
T 1NDB_A1AHQDALPRLPVPPLQQSLDYYLKALQPIVSEEEWAHTKQLVDEFQTSGGVGERLQKGLERRAKKMENWLSEWWLKTAYLQ80 (377)
T ss_pred1CCCCCCCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHCC80 (377)
T ss_dssp1CTGGGSCCCCCCCHHHHHHHHHHHHTTTSCHHHHHHHHHHHHHHTSTTSHHHHHHHHHHHHHHHSSCSSHHHHHHHHTTT80 (377)
Q ss_pred81CCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHCCCCCCCCHHHHHHHCCCCCCCCCCCC160 (377)
Q d20181203_281YRQPVVIYSSPGVMLPWQDFVDLRGVLRFAAPLPSTVLDEKPMISNITIPVEYLGGKNLITLQCYQENSSCRVPGPNQNT160 (377)
T 1NDB_A81FRQPVVIYSSPGVILPKQDFVDLQGQLRFAAKLIEGVLDFKSMIDNETLPVEFLGGQPLCMNQYYQILSSCRVPGPKQDS160 (377)
T ss_pred81CCCCCCCCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCEECCHHHHHHHHHCCCCCCCCCCE160 (377)
T ss_dssp81CCSCSBTTTBCEEEECCCCCCSHHHHHHHHHHHHHHHHHHHHHHHTTCSCCCCSSSCCCCCGGGGTSSSEEEECCSSSCE160 (377)
Q ss_pred161CCCCCCCCCCCCEEEEEECCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEECCCCCCCHHHHHHHHHHHC240 (377)
Q d20181203_2161NSGFRKIRKPPTIIEVVHNYQFFISILYHSDATPLTEGQIFVQIEKIWNSSLQTNKEPVMPLSSNHRNSFYKAMDLLIKK240 (377)
T 1NDB_A161VVNFLKSKRPPTHITVVHNYQFFELDVYHSDGTPLTSDQIFVQLEKIWNSSLQSNKEPVGILTSNHRNTWAKAYNNLIKD240 (377)
T ss_pred161EEECCCCCCCCCEEEEEECCEEEEEEEECCCCEECCHHHHHHHHHHHHHCCCCCCCCCCEECCCCCCHHHHHHHHHHHHC240 (377)
T ss_dssp161EEECTTSSSCCCEEEEEETTEEEEEECBCTTSCBCCHHHHHHHHHHHHHTCCCCCSCCGGGGGGSCHHHHHHHHHHHTTS240 (377)
Q ss_pred241CCCHHHHHHHHHEEEEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCH320 (377)
Q d20181203_2241KVNRDSVRSRSKSAFTKCLDATMPRVAHDVYRSHTACQMLHWGGHRHNIGDREFVKQLQLIVQEIGSLGLFYEHAAAEGP320 (377)
T 1NDB_A241KVNRESVNSIQKSIFTVCLDKQVPRVSDDVYRNHVAGQMLHGGGSKFNSGNRWFDKTLQFIVAEDGSCGMVYEHAAAEGP320 (377)
T ss_pred241HHHHHHHHHHHHEEEEEEECCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEECCCCCEEEEEECCCCCHH320 (377)
T ss_dssp241HHHHHHHHHHHHSSCEEEECCCCCCCCTTTHHHHHHHHHHTCSCTTTTTTSCCTTBSEEEEECTTSCEEEEECTTTCCHH320 (377)
Q ss_pred321HHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHCC377 (377)
Q d20181203_2321PIVTCYLYVIEYTKKPELMFSPLVPLHMPKKLKFNITGEIKFDIEKLKQNTNHAILD377 (377)
T 1NDB_A321PIVALVDHVMEYTKKPELVRSPMVPLPMPKKLRFNITPEIKNDIEKAKQNLSIMIQD377 (377)
T ss_pred321HHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHHHHC377 (377)
T ss_dssp321HHHHHHHHHHHHTTSCCCCCCCCCCCCCCEECCCCCCHHHHHHHHHHHHHHHHHHHT377 (377)


No 4
> 2H3P_A        Alignment in PIR format
MAC score = 295.28	Identity = 0.63

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCHHHHHHHCCCCCC80 (377)
Q d20181203_21VHTWQLPVLPVPAYQHQSHTYLHAARPLVSGYTWAHTCQYVIEFQNSGGVGEGLDKGHEREARMTVSTLSEWALKTIWMQ80 (377)
T 2H3P_A1AHQDALPRLPVPPLQQSLDYYLKALQPIVSEEEWAHTKQLVDEFQTSGGVGERLQKGLERRAKKMENWLSEWWLKTAYLQ80 (377)
T ss_pred1CCCHHCCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHCC80 (377)
T ss_dssp1HHHHHSCCCCCCCHHHHHHHHHHHHTTTSCHHHHHHHHHHHHHHHSTTSHHHHHHHHHHHHHHTSSCTTHHHHHHHHTTT80 (377)
Q ss_pred81CCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHCCCCCCCCHHHHHHHCCCCCCCCCCCC160 (377)
Q d20181203_281YRQPVVIYSSPGVMLPWQDFVDLRGVLRFAAPLPSTVLDEKPMISNITIPVEYLGGKNLITLQCYQENSSCRVPGPNQNT160 (377)
T 2H3P_A81FRQPVVIYSSPGVILPKQDFVDLQGQLRFAAKLIEGVLDFKSMIDNETLPVEFLGGQPLCMNQYYQILSSCRVPGPKQDS160 (377)
T ss_pred81CCCCCCCCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCEEEECCEECCHHHHHHHHHCCCCCCCCCCE160 (377)
T ss_dssp81CCSCSBTTTBCEEEECCCCCCSHHHHHHHHHHHHHHHHHHHHHHHTTCCCCCBSSSSBCCCTTHHHHTTEEEECCSSSCE160 (377)
Q ss_pred161CCCCCCCCCCCCEEEEEECCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEECCCCCCCHHHHHHHHHHHC240 (377)
Q d20181203_2161NSGFRKIRKPPTIIEVVHNYQFFISILYHSDATPLTEGQIFVQIEKIWNSSLQTNKEPVMPLSSNHRNSFYKAMDLLIKK240 (377)
T 2H3P_A161VVNFLKSKRPPTHITVVHNYQFFELDVYHSDGTPLTSDQIFVQLEKIWNSSLQSNKEPVGILTSNHRNTWAKAYNNLIKD240 (377)
T ss_pred161EEECCCCCCCCCEEEEEECCEEEEEEEECCCCEECCHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCHHHHHHHHHHHC240 (377)
T ss_dssp161EEECTTSSSCCCEEEEEETTEEEEEECBCTTSCBCCHHHHHHHHHHHHHTCCSCCSCCGGGGGGSCHHHHHHHHHHHTTS240 (377)
Q ss_pred241CCCHHHHHHHHHEEEEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCH320 (377)
Q d20181203_2241KVNRDSVRSRSKSAFTKCLDATMPRVAHDVYRSHTACQMLHWGGHRHNIGDREFVKQLQLIVQEIGSLGLFYEHAAAEGP320 (377)
T 2H3P_A241KVNRESVNSIQKSIFTVCLDKQVPRVSDDVYRNHVAGQMLHGGGSKFNSGNRWFDKTLQFIVAEDGSCGMVYEHAAAEGP320 (377)
T ss_pred241CCCHHHHHHHHHEEEEEEECCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEECCCCCEEEEEECCCCCHH320 (377)
T ss_dssp241HHHHHHHHHHHHSSCEEEECCCCCCCCHHHHHHHHHHHHHTCSCTTTTTTSCCTTBSEEEEECTTSCEEEEECTTTCCHH320 (377)
Q ss_pred321HHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHCC377 (377)
Q d20181203_2321PIVTCYLYVIEYTKKPELMFSPLVPLHMPKKLKFNITGEIKFDIEKLKQNTNHAILD377 (377)
T 2H3P_A321PIVALVDHVMEYTKKPELVRSPMVPLPMPKKLRFNITPEIKNDIEKAKQNLSIMIQD377 (377)
T ss_pred321HHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHC377 (377)
T ss_dssp321HHHHHHHHHHHHHTSCCCCCCCCCCCCCCEEECCCCCHHHHHHHHHHHHHHHHHHHH377 (377)


No 5
> 1NM8_A    Carnitine O-acetyltransferase; two equally sized domains, anti-parallel beta-strand; 1.60A {Homo sapiens} SCOP: c.43.1.3 c.43.1.3 PDB: 1s5o_A* 2h3u_A* 2h3p_A* 1t7q_A* 1t7n_A 1t7o_A* 1ndb_A 1ndf_A* 1ndi_A* 2h3w_A*     Alignment in PIR format
MAC score = 293.64	Identity = 0.69

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCHHHHHHHCCCCCC80 (377)
Q d20181203_21VHTWQLPVLPVPAYQHQSHTYLHAARPLVSGYTWAHTCQYVIEFQNSGGVGEGLDKGHEREARMTVSTLSEWALKTIWMQ80 (377)
T 1NM8_A1HHTDPLPRLPVPPLQQSLDHYLKALQPIVSEEEWAHTKQLVDEFQASGGVGERLQKGLERRARKTENWLSEWWLKTAYLQ80 (377)
T ss_pred1CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHC80 (377)
T ss_dssp1CCCCCCCCCCCCCHHHHHHHHHHHHTTTSCHHHHHHHHHHHHHHHSTTSHHHHHHHHHHHHHHHSSSTTHHHHHHHHTTT80 (377)
Q ss_pred81CCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHCCCCCCCCHHHHHHHCCCCCCCCCCCC160 (377)
Q d20181203_281YRQPVVIYSSPGVMLPWQDFVDLRGVLRFAAPLPSTVLDEKPMISNITIPVEYLGGKNLITLQCYQENSSCRVPGPNQNT160 (377)
T 1NM8_A81YRQPVVIYSSPGVMLPKQDFVDLQGQLRFAAKLIEGVLDFKVMIDNETLPVEYLGGKPLCMNQYYQILSSCRVPGPKQDT160 (377)
T ss_pred81CCCCCCCCCCCCEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCEECCCCCCCE160 (377)
T ss_dssp81CCSCSBTTTBCEEECCCCCCCSHHHHHHHHHHHHHHHHHHHHHHHHTCCCCCEETTEECCCGGGGGTTTEEEECCSSSCE160 (377)
Q ss_pred161CCCCCCCCCCCCEEEEEECCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEECCCCCCCHHHHHHHHHHHC240 (377)
Q d20181203_2161NSGFRKIRKPPTIIEVVHNYQFFISILYHSDATPLTEGQIFVQIEKIWNSSLQTNKEPVMPLSSNHRNSFYKAMDLLIKK240 (377)
T 1NM8_A161VSNFSKTKKPPTHITVVHNYQFFELDVYHSDGTPLTADQIFVQLEKIWNSSLQTNKEPVGILTSNHRNSWAKAYNTLIKD240 (377)
T ss_pred161EEECCCCCCCCCEEEEEECCEEEEEEEECCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHC240 (377)
T ss_dssp161EEECTTSSSCCCEEEEEETTEEEEEECBCTTSCBCCHHHHHHHHHHHHHTCCCCCSCCGGGGGGSCHHHHHHHHHHHTTS240 (377)
Q ss_pred241CCCHHHHHHHHHEEEEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCH320 (377)
Q d20181203_2241KVNRDSVRSRSKSAFTKCLDATMPRVAHDVYRSHTACQMLHWGGHRHNIGDREFVKQLQLIVQEIGSLGLFYEHAAAEGP320 (377)
T 1NM8_A241KVNRDSVRSIQKSIFTVCLDATMPRVSEDVYRSHVAGQMLHGGGSRLNSGNRWFDKTLQFIVAEDGSCGLVYEHAAAEGP320 (377)
T ss_pred241CHHHHHHHHHHHHEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCEEEEECCCCEEEEECCCCCCCH320 (377)
T ss_dssp241HHHHHHHHHHHHSSCEEEEECCCSCCCSTTHHHHHHHHHHHCSCTTTTTTSCCTTBSEEEEEETTSCEEEEECTTSCCHH320 (377)
Q ss_pred321HHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHCC377 (377)
Q d20181203_2321PIVTCYLYVIEYTKKPELMFSPLVPLHMPKKLKFNITGEIKFDIEKLKQNTNHAILD377 (377)
T 1NM8_A321PIVTLLDYVIEYTKKPELVRSPMVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQD377 (377)
T ss_pred321HHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHH377 (377)
T ss_dssp321HHHHHHHHHHHHHHSCCCCCCCCCCCCCCEEECCCCCHHHHHHHHHHHHHHHHHHHH377 (377)


No 6
> 1T7Q_A        Alignment in PIR format
MAC score = 293.13	Identity = 0.63

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCHHHHHHHCCCCCC80 (377)
Q d20181203_21VHTWQLPVLPVPAYQHQSHTYLHAARPLVSGYTWAHTCQYVIEFQNSGGVGEGLDKGHEREARMTVSTLSEWALKTIWMQ80 (377)
T 1T7Q_A1AHQDALPRLPVPPLQQSLDYYLKALQPIVSEEEWAHTKQLVDEFQTSGGVGERLQKGLERRAKKMENWLSEWWLKTAYLQ80 (377)
T ss_pred1CCHHHCCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCCCCHHHHHHHHCC80 (377)
T ss_dssp1HHHHTSCCCCCCCHHHHHHHHHHHHTTTSCHHHHHHHHHHHHHHTSTTSHHHHHHHHHHHHHHHSSCSSHHHHHHHHTTT80 (377)
Q ss_pred81CCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHCCCCCCCCHHHHHHHCCCCCCCCCCCC160 (377)
Q d20181203_281YRQPVVIYSSPGVMLPWQDFVDLRGVLRFAAPLPSTVLDEKPMISNITIPVEYLGGKNLITLQCYQENSSCRVPGPNQNT160 (377)
T 1T7Q_A81FRQPVVIYSSPGVILPKQDFVDLQGQLRFAAKLIEGVLDFKSMIDNETLPVEFLGGQPLCMNQYYQILSSCRVPGPKQDS160 (377)
T ss_pred81CCCCCCCCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCEECCHHHHHHHHHCCCCCCCCCCE160 (377)
T ss_dssp81CCSCSBTTTBCEEECCCCCCCSHHHHHHHHHHHHHHHHHHHHHHHTTCCCCCBSSSCBCCCGGGGTSSSEEEECCSSSCE160 (377)
Q ss_pred161CCCCCCCCCCCCEEEEEECCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEECCCCCCCHHHHHHHHHHHC240 (377)
Q d20181203_2161NSGFRKIRKPPTIIEVVHNYQFFISILYHSDATPLTEGQIFVQIEKIWNSSLQTNKEPVMPLSSNHRNSFYKAMDLLIKK240 (377)
T 1T7Q_A161VVNFLKSKRPPTHITVVHNYQFFELDVYHSDGTPLTSDQIFVQLEKIWNSSLQSNKEPVGILTSNHRNTWAKAYNNLIKD240 (377)
T ss_pred161EEECCCCCCCCCEEEEEECCEEEEEEEECCCCEECCHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCHHHHHHHHHHHC240 (377)
T ss_dssp161EEECTTSSSCCCEEEEEETTEEEEEECBCTTSCBCCHHHHHHHHHHHHHTTCCCCSCCGGGGGGSCHHHHHHHHHHHTTS240 (377)
Q ss_pred241CCCHHHHHHHHHEEEEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCH320 (377)
Q d20181203_2241KVNRDSVRSRSKSAFTKCLDATMPRVAHDVYRSHTACQMLHWGGHRHNIGDREFVKQLQLIVQEIGSLGLFYEHAAAEGP320 (377)
T 1T7Q_A241KVNRESVNSIQKSIFTVCLDKQVPRVSDDVYRNHVAGQMLHGGGSKFNSGNRWFDKTLQFIVAEDGSCGMVYEHAAAEGP320 (377)
T ss_pred241CCCHHHHHHHHHEEEEEEECCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEECCCCCEEEEEECCCCCHH320 (377)
T ss_dssp241HHHHHHHHHHHHSSCEEEECCCCCCCCTTSHHHHHHHHHHTCSCTTTTTTSCCTTBSEEEEECTTSCEEEEECTTSCCHH320 (377)
Q ss_pred321HHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHCC377 (377)
Q d20181203_2321PIVTCYLYVIEYTKKPELMFSPLVPLHMPKKLKFNITGEIKFDIEKLKQNTNHAILD377 (377)
T 1T7Q_A321PIVALVDHVMEYTKKPELVRSPMVPLPMPKKLRFNITPEIKNDIEKAKQNLSIMIQD377 (377)
T ss_pred321HHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHC377 (377)
T ss_dssp321HHHHHHHHHHHHTTSCCCCCCCCCCCCCCEEECCCCCHHHHHHHHHHHHHHHHHHHH377 (377)


No 7
> 1T1U_A    Choline O-acetyltransferase; choline acetyltransferase; 1.55A {Rattus norvegicus} SCOP: c.43.1.3 c.43.1.3 PDB: 1q6x_A 2fy2_A 2fy3_A 2fy4_A* 2fy5_A*     Alignment in PIR format
MAC score = 255.45	Identity = 0.28

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCHHHHHHHCCCCCC80 (387)
Q d20181203_21VHTWQLPVLPVPAYQHQSHTYLHAARPLVSGYTWAHTCQYVIEFQNSGGVGEGLDKGHEREARMTVSTLSEWALKTIWMQ80 (387)
T 1T1U_A1WEELDLPKLPVPPLQQTLATYLQCMQHLVPEEQFRKSQAIVKRFGAPGGLGETLQEKLLERQEKTANWVSEYWLNDMYLN80 (387)
T ss_pred1CCCCCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHCC80 (387)
T ss_dssp1UUCTTSCCCCCCCHHHHHHHHHHHHGGGSCHHHHHHHHHHHHHHTSTTSHHHHHHHHHHHHHHHSSSTTHHHHHHHHTTT80 (387)
Q ss_pred81CCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHCC----CCCCCCHHHHHHHCCCCCCCC160 (387)
Q d20181203_281YRQPVVIYSSPGVMLPWQDFVDLRGVLRFAAPLPSTVLDEKPMISNITIPVEYLG----GKNLITLQCYQENSSCRVPGP160 (387)
T 1T1U_A81NRLALPVNSSPAVIFARQHFQDTNDQLRFAACLISGVLSYKTLLDSHSLPTDWAKGQLSGQPLCMKQYYRLFSSYRLPGH160 (387)
T ss_pred81CCCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCEEHHHCCCCCCCCHHHHHHHCCCCCCCCC160 (387)
T ss_dssp81CCSCHHHHTCCEEEECCCCCSSHHHHHHHHHHHHHHHHHHHHHHHHTCSCCTTSSSCCSSSCCCCTTGGGTTTEEEECCS160 (387)
Q ss_pred161CCCCCCCCC-CCCCCCCEEEEEECCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCC--CCCEECCCCCCCHHHHH240 (387)
Q d20181203_2161NQNTNSGFR-KIRKPPTIIEVVHNYQFFISILYHSDATPLTEGQIFVQIEKIWNSSLQTNK--EPVMPLSSNHRNSFYKA240 (387)
T 1T1U_A161TQDTLVAQKSSIMPEPEHVIVACCNQFFVLDVVI-NFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAKA240 (387)
T ss_pred161CCCEEEECCCCCCCCCCEEEEEECCEEEEEEEEE-CCEECCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHH240 (387)
T ss_dssp161SSCEEEECCCSSSSCCCEEEEEETTEEEEEESEE-TTEECCHHHHHHHHHHHHHHHTCSTTCCCCGGGGGGSCHHHHHHH240 (387)
Q ss_pred241HHHHHHCCCCHHHHHHHHHEEEEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCC320 (387)
Q d20181203_2241MDLLIKKKVNRDSVRSRSKSAFTKCLDATMPRVAHDVYRSHTACQMLHWGGHRHNIGDREFVKQLQLIVQEIGSLGLFYE320 (387)
T 1T1U_A241RTVLLKDSTNRDSLDMIERCICLVCLDGPGT---GELSDTHRALQLLHGGGCSLNGANRWYDKSLQFVVGRDGTCGVVCE320 (387)
T ss_pred241HHHHHCCCHHHHHHHHHHHEEEEEEEECCCC---CCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEECCCCEEEEEC320 (387)
T ss_dssp241HHHHTTSHHHHHHHHHHHTCSCEEEECCCCS---SCCCHHHHHHHHHHTTSTTTTTTSCCTTBSEEEEECTTSCEEEEEC320 (387)
Q ss_pred321CCCCCCHHHHHHHHHHHHHHCCCCCCC---CCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHCC387 (387)
Q d20181203_2321HAAAEGPPIVTCYLYVIEYTKKPELMF---SPLVPLHMPKKLKFNITGEIKFDIEKLKQNTNHAILD387 (387)
T 1T1U_A321HSPFDGIVLVQCTEHLLKHMMTSNKKLVRADSVSELPAPRRLRWKCSPETQGHLASSAEKLQRIVKN387 (387)
T ss_pred321CCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHH387 (387)
T ss_dssp321STTCCHHHHHHHHHHHHHHHTCCTTSCSSSCSCCCCCCCEECCCCCCHHHHHHHHHHHHHHHHHHHH387 (387)


No 8
> 1Q6X_A        Alignment in PIR format
MAC score = 254.84	Identity = 0.28

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCHHHHHHHCCCCCC80 (387)
Q d20181203_21VHTWQLPVLPVPAYQHQSHTYLHAARPLVSGYTWAHTCQYVIEFQNSGGVGEGLDKGHEREARMTVSTLSEWALKTIWMQ80 (387)
T 1Q6X_A1WEELDLPKLPVPPLQQTLATYLQCMQHLVPEEQFRKSQAIVKRFGAPGGLGETLQEKLLERQEKTANWVSEYWLNDMYLN80 (387)
T ss_pred1CCCHHCCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCEECHHHHHHHHCC80 (387)
T ss_dssp1CCCTTSCCCCCCCHHHHHHHHHHHHHTTSCHHHHHHHHHHHHHHHSTTSHHHHHHHHHHHHHHHSSCTTHHHHHHHHTTT80 (387)
Q ss_pred81CCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHCC----CCCCCCHHHHHHHCCCCCCCC160 (387)
Q d20181203_281YRQPVVIYSSPGVMLPWQDFVDLRGVLRFAAPLPSTVLDEKPMISNITIPVEYLG----GKNLITLQCYQENSSCRVPGP160 (387)
T 1Q6X_A81NRLALPVNSSPAVIFARQHFQDTNDQLRFAACLISGVLSYKTLLDSHSLPTDWAKGQLSGQPLCMKQYYRLFSSYRLPGH160 (387)
T ss_pred81CCCCCCCCCCHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHCCCCCCCHHHHHHHHCCCCCCCC160 (387)
T ss_dssp81CCSCHHHHTBCEEECCCCCCSSHHHHHHHHHHHHHHHHHHHHHHHTTCSCCCEECCSSCCEECCCGGGGGSSSEEEECCS160 (387)
Q ss_pred161CCCCCCCCCC-CCCCCCEEEEEECCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCC--CCEECCCCCCCHHHHH240 (387)
Q d20181203_2161NQNTNSGFRK-IRKPPTIIEVVHNYQFFISILYHSDATPLTEGQIFVQIEKIWNSSLQTNKE--PVMPLSSNHRNSFYKA240 (387)
T 1Q6X_A161TQDTLVAQKSSIMPEPEHVIVACCNQFFVLDVVI-NFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAKA240 (387)
T ss_pred161CCCEEEECCCCCCCCCCEEEEEECCEEEEEEEEC-CCEECCHHHHHHHHHHHHHHCCCCCCCCCCEEEECCCCHHHHHHH240 (387)
T ss_dssp161SSCEEEECCTTSCSCCCEEEEEETTEEEEEESEE-TTEECCHHHHHHHHHHHHHHHHCGGGCCCCGGGGGGSCHHHHHHH240 (387)
Q ss_pred241HHHHHHCCCCHHHHHHHHHEEEEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCC320 (387)
Q d20181203_2241MDLLIKKKVNRDSVRSRSKSAFTKCLDATMPRVAHDVYRSHTACQMLHWGGHRHNIGDREFVKQLQLIVQEIGSLGLFYE320 (387)
T 1Q6X_A241RTVLLKDSTNRDSLDMIERCICLVCLDGPG---TGELSDTHRALQLLHGGGCSLNGANRWYDKSLQFVVGRDGTCGVVCE320 (387)
T ss_pred241HHHHHHCHHHHHHHHHHHHEEEEEEECCCC---CCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEECCCCCEEEEEE320 (387)
T ss_dssp241HHHHTTSHHHHHHHHHHHTCSCEEEECCCC---CSCCCHHHHHHHHHHTTSTTTTTTSCCTTBSEEEEECTTSCEEEEEC320 (387)
Q ss_pred321CCCCCCHHHHHHHHHHHHHHCCCCCC---CCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHCC387 (387)
Q d20181203_2321HAAAEGPPIVTCYLYVIEYTKKPELM---FSPLVPLHMPKKLKFNITGEIKFDIEKLKQNTNHAILD387 (387)
T 1Q6X_A321HSPFDGIVLVQCTEHLLKHMMTSNKKLVRADSVSELPAPRRLRWKCSPETQGHLASSAEKLQRIVKN387 (387)
T ss_pred321CCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHC387 (387)
T ss_dssp321STTCCHHHHHHHHHHHHHTTCCUUUUUUUUUUUUCCCCCEECCCCCCHHHHHHHHHHHHHHHHHHHH387 (387)


No 9
> 2FY5_A        Alignment in PIR format
MAC score = 245.11	Identity = 0.31

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCHHHHHHHCCCCCC80 (384)
Q d20181203_21VHTWQLPVLPVPAYQHQSHTYLHAARPLVSGYTWAHTCQYVIEFQNSGGVGEGLDKGHEREARMTVSTLSEWALKTIWMQ80 (384)
T 2FY5_A1SEESGLPKLPVPPLQQTLATYLQCMRHLVSEEQFRKSQAIVQQFGAPGGLGETLQQKLLERQEKTANWVSEYWLNDMYLN80 (384)
T ss_pred1CHHCCCCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCEECHHHHHHHHCC80 (384)
T ss_dssp1UUUCCSCCCCCCCHHHHHHHHHHHHGGGSCHHHHHHHHHHHHHHHSTTSHHHHHHHHHHHHHHHSSSTTHHHHHHHHTTT80 (384)
Q ss_pred81CCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHCC----CCCCCCHHHHHHHCCCCCCCC160 (384)
Q d20181203_281YRQPVVIYSSPGVMLPWQDFVDLRGVLRFAAPLPSTVLDEKPMISNITIPVEYLG----GKNLITLQCYQENSSCRVPGP160 (384)
T 2FY5_A81NRLALPVNSSPAVIFARQHFPGTDDQLRFAASLISGVLSYKALLDSHSIPTDCAKGQLSGQPLCMKQYYGLFSSYRLPGH160 (384)
T ss_pred81CCCCCCCCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEECCCCCCCCCCCHHHHHHHCCCCCCCCC160 (384)
T ss_dssp81CCSCHHHHTBCEEECCCCCCSSHHHHHHHHHHHHHHHHHHHHHHHTTCSCCCBCCSSSCSSBCCCTTGGGSSSCBEECCS160 (384)
Q ss_pred161CCCCCCCCC-CCCCCCCEEEEEECCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCC--CCCCEECCCCCCCHHHHH240 (384)
Q d20181203_2161NQNTNSGFR-KIRKPPTIIEVVHNYQFFISILYHSDATPLTEGQIFVQIEKIWNSSLQTN--KEPVMPLSSNHRNSFYKA240 (384)
T 2FY5_A161TQDTLVAQNSSIMPEPEHVIVACCNQFFVLDVV-INFRRLSEGDLFTQLRKIVKMASNAAARLPPIGLLTSDGRSEWAEA240 (384)
T ss_pred161CCCEEEECCCCCCCCCCEEEEEECCEEEEEEEE-CCCEECCHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHH240 (384)
T ss_dssp161SCCEECUUUUUUCCSSEEEEEEETTEEEEEEEE-SSSCBCCHHHHHHHHHHHHHHTTCTTTCCCCGGGGGGSCHHHHHHH240 (384)
Q ss_pred241HHHHHHCCCCHHHHHHHHHEEEEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCC320 (384)
Q d20181203_2241MDLLIKKKVNRDSVRSRSKSAFTKCLDATMPRVAHDVYRSHTACQMLHWGGHRHNIGDREFVKQLQLIVQEIGSLGLFYE320 (384)
T 2FY5_A241RTVLVKDSTNRDSLDMIERCICLVCLDAPG---GVELSDTHRALQLLHGGGYSKNGANRWYDKSLQFVVGRDGTCGVVCE320 (384)
T ss_pred241HHHHHHCHHHHHHHHHHHHEEEEEEECCCC---CCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEEECCCCEEEEEE320 (384)
T ss_dssp241HHHHTTSHHHHHHHHHHHTSSCEEECCCCC---SSCCCHHHHHHHHHTTTSTTTTTTSCCTTBSEEEEECTTSCEEEEEC320 (384)
Q ss_pred321CCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHCC384 (384)
Q d20181203_2321HAAAEGPPIVTCYLYVIEYTKKPELMFSPLVPLHMPKKLKFNITGEIKFDIEKLKQNTNHAILD384 (384)
T 2FY5_A321HSPFDGIVLVQCTEHLLKHMTQPELVRSPMVPLPAPRRLRWKCSPEIQGHLASSAEKLQRIVKN384 (384)
T ss_pred321CCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHC384 (384)
T ss_dssp321STTCCHHHHHHHHHHHHHHCUUUUUUUUUUUCCCCCEECCCCCCHHHHHHHHHHHHHHHHHHHH384 (384)


No 10
> 1XMD_A        Alignment in PIR format
MAC score = 224.68	Identity = 0.22

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCHHHHHHHCCCCCC80 (388)
Q d20181203_21VHTWQLPVLPVPAYQHQSHTYLHAARPLVSGYTWAHTCQYVIEFQNSGGVGEGLDKGHEREARMTVSTLSEWALKTIWMQ80 (388)
T 1XMD_A1QYQDSLPSLPVPALEESLKKYLESVKPFANEDEYKKTEEIVQKFQE--GAGKRLHQKLLERARGKRNWLEEWWLNVAYLD80 (388)
T ss_pred1CCHHHCCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHCCCCCCCCCHHHHHHHHCC80 (388)
T ss_dssp1TTGGGCCCCCCCCHHHHHHHHHHHHGGGCCHHHHHHHHHHHHHHHH--THHHHHHHHHHHHHHTCSCSSHHHHHHHHTTS80 (388)
Q ss_pred81CCCCEEEECCCCCC---CCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHCCCCCCCCHHHHHHHCCCCCCCCC160 (388)
Q d20181203_281YRQPVVIYSSPGVM---LPWQDFVDLRGVLRFAAPLPSTVLDEKPMISNITIPVEYLGGKNLITLQCYQENSSCRVPGPN160 (388)
T 1XMD_A81VRIPSQLNVNFVGPCPHFEHYWPAREGTQLERGSMMLWHNLNYWQLLRREKLPVHKSGNTPLDMNQFRMLFSTCKVPGIT160 (388)
T ss_pred81CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCEECCHHHHHHHHCCCCCCCCC160 (388)
T ss_dssp81CCSCHHHHTCEEEECGGGGTTCCSCTTCHHHHHHHHHHHHHHHHHHHHTTCSCCCEETTEECCCGGGGGSSSEEEECCSS160 (388)
Q ss_pred161CCCCCCCCCCC---CCCCEEEEEECCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCC-CCCEECCCCCCCHHHHH240 (388)
Q d20181203_2161QNTNSGFRKIR---KPPTIIEVVHNYQFFISILYHSDATPLTEGQIFVQIEKIWNSSLQTNK-EPVMPLSSNHRNSFYKA240 (388)
T 1XMD_A161RDSIMNYFKTESEGHCPTHIAVLCRGRAFVFDVLHE-GCLITPPELLRQLTYIHKKCSNEPVGPSIAALTSEERTRWAKA240 (388)
T ss_pred161CCEEEECCCCCCCCCCCCEEEEEECCEEEEEEEEEC-CEECCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHH240 (388)
T ss_dssp161CCEEEECCCCTTTCCCCCEEEEEETTEEEEEESEET-TEECCHHHHHHHHHHHHHHHHTSCCCCCGGGGGGSCHHHHHHH240 (388)
Q ss_pred241HHHHHH-CCCCHHHHHHHHHEEEEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCEEEECCCCCCCCCC320 (388)
Q d20181203_2241MDLLIK-KKVNRDSVRSRSKSAFTKCLDATMPRVAHDVYRSHTACQMLHWGGHRHNIGDREFVKQLQLIVQEIGSLGLFY320 (388)
T 1XMD_A241REYLISLDPENLTLLEKIQTSLFVYSIEDSSPHATPEE--YSQVFEMLLGG----DPSVRWGDKSYNLISFANGIFGCCC320 (388)
T ss_pred241HHHHHCCCHHHHHHHHHHHHCCEEEEECCCCCCCCCHH--HHHHHHHHCCC----CCCCCCCCCCEEEEECCCCCEEEEE320 (388)
T ss_dssp241HHHHHHHCHHHHHHHHHHHHSSCEEEECCCCCCCCSSC--CHHHHHHHHSS----CGGGCCTTBSCEEEECTTSCEEEEE320 (388)
Q ss_pred321CCCCCCCHHHHHHHHHHHHHHCCCCCCC---CCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHCC388 (388)
Q d20181203_2321EHAAAEGPPIVTCYLYVIEYTKKPELMF---SPLVPLHMPKKLKFNITGEIKFDIEKLKQNTNHAILD388 (388)
T 1XMD_A321DHAPYDAMVVVNIAHYVDERVLETEGRWKGSEKVRDIPLPEELVFTVDEKILNDVSQAKAQHLKAASD388 (388)
T ss_pred321ECCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHC388 (388)
T ss_dssp321CSSSCCTHHHHHHHHHHHHHHHHTTTCCCSCCCCCCCCCCEECCCCCCHHHHHHHHHHHHHHHHHHTT388 (388)