TreeThreader - Results

  Job information

Job ID: d20180709
#Proteins: 4
Protein ID: d20180709_3
Fasta ID: seq3
Submission time: 2018-07-09 10:54:02 +0800
Finished time: 2019-02-17 15:17:51 +0800
Identical Job(s): NULL

  Alignments

1
50
100
133
3QFA_A 3QFA_A 1ZDL_A 1ZDL_A 1Z85_B 1Z85_B 3C7U_B 3C7U_B 3KW2_A 3KW2_A 1JTG_B 1JTG_B 2WIA_A 2WIA_A 1Y0B_A 1Y0B_A 2FXV_A 2FXV_A 2AQ1_B 2AQ1_B

  Build multi-template model (choose up to 5 templates)

                   
Download full-length structure

  Top 10 hits

Query:
Job ID  : d20180709_3
Length : 133
Sequence: YRNVMPTNFTPLEYGCCILSEEKYVVKFGEENIEVYHSFWWPLEWTHISRDNNKCYHKVWCNLRDYCKVVIGHVIKKNAG EVTEGFESALCCGLYKQFLDSTIEWPPVLAEIFTWLSVTKQSGLDQVQASCFM

No Hit MAC Score Identity Cols Query HMM Template HMM
13QFA_A63.920.651331-133387-519
21ZDL_A61.250.411331-133385-517
31Z85_B46.110.091291-13313-186
43C7U_B45.410.161291-1321-165
53KW2_A45.120.081291-1334-197
61JTG_B42.520.151291-1321-165
72WIA_A42.060.081281-1331-178
81Y0B_A41.430.11311-13315-193
92FXV_A41.130.11261-13346-194
102AQ1_B40.850.141321-13328-234

  Pairwise Query-Template Alignment

No 1
> 3QFA_A    Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A*     Alignment in PIR format
MAC score = 63.92	Identity = 0.65

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCEEEEECEEECCEEEEEEECCCCEEEEEEEECCCCCCEEEEEEECCCCH80 (133)
Q d20180709_31YRNVMPTNFTPLEYGCCILSEEKYVVKFGEENIEVYHSFWWPLEWTHISRDNNKCYHKVWCNLRDYCKVVIGHVIKKNAG80 (133)
T 3QFA_A1YENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAG80 (133)
T ss_pred1CCCCCEEEECCCCEEEEECCHHHHHHHCCCCCEEEEEEECCCHHHHHHCCCCCCEEEEEEEECCCCCEEEEEEEECCCHH80 (133)
T ss_dssp1CTTCCEEECSSSCEEEEECCHHHHHHHHCGGGEEEEEEEECCHHHHTTTCCTTTEEEEEEEETTTTCEEEEEEEESTTHH80 (133)
Q ss_pred81HHHHHHHHHHHCCCCHHCCCCCCCCCCCCCCEEEEEEEEECCCCCCCCCCCCC133 (133)
Q d20180709_381EVTEGFESALCCGLYKQFLDSTIEWPPVLAEIFTWLSVTKQSGLDQVQASCFM133 (133)
T 3QFA_A81EVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGSCG133 (133)
T ss_pred81HHHHHHHHHHHCCCCHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCHHHCCCCC133 (133)
T ss_dssp81HHHHHHHHHHHTTCBHHHHHHSCCCTTCGGGGGGGCCCBTTTTCCCCCCCTTC133 (133)


No 2
> 1ZDL_A        Alignment in PIR format
MAC score = 61.25	Identity = 0.41

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCEEEEECEEECCEEEEEEECCCCEEEEEEEECCCCCCEEEEEEECCCCH80 (133)
Q d20180709_31YRNVMPTNFTPLEYGCCILSEEKYVVKFGEENIEVYHSFWWPLEWTHISRDNNKCYHKVWCNLRDYCKVVIGHVIKKNAG80 (133)
T 1ZDL_A1YSNVPTTVFTPLEYGCVGLSEEEAVALHGQEHVEVYHAYYKPLEFTVADRDASQCYIKMVCMREPPQLVLGLHFLGPNAG80 (133)
T ss_pred1HHHCCEEEECCCCCEEECCCHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCCEEEEEEEECCCCCEEEEEEEECCCHH80 (133)
T ss_dssp1CTTCCEEECSSSEEEEEECCHHHHHHHHCGGGEEEEEEECCCHHHHHTTCCCTTCEEEEEEESSTTCBEEEEEEEETTHH80 (133)
Q ss_pred81HHHHHHHHHHHCCCCHHCCCCCCCCCCCCCCEEEEEEEEECCCCCCCCCCCCC133 (133)
Q d20180709_381EVTEGFESALCCGLYKQFLDSTIEWPPVLAEIFTWLSVTKQSGLDQVQASCFM133 (133)
T 1ZDL_A81EVTQGFALGIKCGASYAQVMQTVGIHPTCSEEVVKLHISKRSGLEPTVTGCCG133 (133)
T ss_pred81HHHHHHHHHHHCCCCHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCC133 (133)
T ss_dssp81HHHHHHHHHHHHTCBHHHHHSSCCCSSCSGGGGGGCCCBTTTTCCCBCCCUUU133 (133)


No 3
> 1Z85_B        Alignment in PIR format
MAC score = 46.11	Identity = 0.09

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCCCCCHHHHHHHH------CCCCEEEEECEEECCEEEEEEECCCCEEEEEEEECCCCC---CEEE80 (178)
Q d20180709_31YRNVMPTNFTPLEYGCCILSEEKYVVKF------GEENIEVYHSFWWPLEWTHISRDNNKCYHKVWCNLRDYC---KVVI80 (178)
T 1Z85_B1MPHLFYGT---AQNGEV-IFDEREAHHMRVVRLKEGDVIEATDGNGFSYTCILKSLKKKTAAAKIVKVEEKEKEPTEKLS80 (178)
T ss_pred1CCEEEECC---CCCCEE-EECHHHHHEEEEEECCCCCEEEEEECCCCEEEEEEEEECCCEEEEEEEEEECCCCCCCCCEE80 (178)
T ss_dssp1UCCEEECE---EETTEE-EECHHHHHHHHHTTCCTTCEEEEECSBSEEEEEEEEEECSSCEEEEEEEEEECCCCCSSCEE80 (178)
Q ss_pred81EEEECCCCHHHHHHHHHHHHCCCCHHCCCCC------------------------CCCCCCCCC------EEEEEEEEEC160 (178)
Q d20180709_381GHVIKKNAGEVTEGFESALCCGLYKQFLDST------------------------IEWPPVLAE------IFTWLSVTKQ160 (178)
T 1Z85_B81VVVPIGRWERTRFLIEKCVELGVDEIFFHKFERSQHEISLDKAKIVVREAAKQCKRYLFPKVSFLEKLEFSGNVITLDLD160 (178)
T ss_pred81EEEECCCCCHHHHHHHHHHHCCCCEEEEEEEEEEEECCCHHHHHHHHHHHHHHHCCCCCCCCCHHHCCCCCCCEEEECCC160 (178)
T ss_dssp81EEEECCCHHHHHHHHHHHHHTTCSEEEEECCTTCCCCCCHHHHHHHHHHHHHHHTCSBCCEEEECCSSCCCSEEEEECTT160 (178)
Q ss_pred161CCC-----CC-CCCCCCC178 (178)
Q d20180709_3161SGL-----DQ-VQASCFM178 (178)
T 1Z85_B161ASQNLLDANLEGSITVVV178 (178)
T ss_pred161CCCCCCCCCCCCCEEEEE178 (178)
T ss_dssp161CCCCTTTSCCCSSEEEEE178 (178)


No 4
> 3C7U_B        Alignment in PIR format
MAC score = 45.41	Identity = 0.16

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCEEEEECEEECCEEEEEEECCCCEEEEEEEECCCCC-CEEEEEEECCCC80 (168)
Q d20180709_31YRNVMPTNFTPLEYGCCILSEEKYVVKFGEENIEVYHSFWWPLEWTHISRDNNKCYHKVWCNLRDYC-KVVIGHVIKKNA80 (168)
T 3C7U_B1AGVMTGAKFTQ---IQFGMTRQQVLDIAGAENCETGGSFGDSIHCRGHAAGDYYAYATFGFTSAAADAKVDSKSQEKLLA80 (168)
T ss_pred1CCCCCHHHHHH---EECCCCHHHHHHHCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCC80 (168)
T ss_dssp1CCCCCHHHHHH---CCTTCCHHHHHHHHTGGGEEESGGGTTCEEEEEEEETTEEEEEEEEESSSSTTCCEEEEEEESSSC80 (168)
Q ss_pred81---HHHHHHHHHHHHCCCCHHCCCCCCC-------------------------CCCCC-------CCEEEEEEEEECCCC160 (168)
Q d20180709_381---GEVTEGFESALCCGLYKQFLDSTIE-------------------------WPPVL-------AEIFTWLSVTKQSGL160 (168)
T 3C7U_B81PSAPTLTLAKFNQVTVGMTRAQVLATVGQGSCTTWSEYYPAYPSTAGVTLSLSCFDVDGYSSTGFYRGSAHLAFTDGVLQ160 (168)
T ss_pred81CCCCEEEEEECCCEEECCEEEEEEEECCCCCCCCHHHHCCCCCCCCCEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEE160 (168)
T ss_dssp81CSBCCCCHHHHHHCCTTCBHHHHHHHHCTBSEEEEEEECTTTTSCTTCEEEEEEECTTTCCSSSCCSSEEEEEEETTEEE160 (168)
Q ss_pred161CCCCCCCC168 (168)
Q d20180709_3161DQVQASCF168 (168)
T 3C7U_B161GKRQWDLV168 (168)
T ss_pred161CCEEECCC168 (168)
T ss_dssp161EEEEESCC168 (168)


No 5
> 3KW2_A    Probable R-RNA methyltransferase; structural genomics, unknown function, PSI-2, protein structure initiative; HET: MSE ADN; 2.00A {Porphyromonas gingivalis atcc 33277}     Alignment in PIR format
MAC score = 45.12	Identity = 0.08

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCCCCCHHHHHHHHC-------CCCEEEEECEEECCEEEEEEECCCCEEEEEEEECCCC----CCE80 (198)
Q d20180709_31YRNVMPTNFTPLEYGCCILSEEKYVVKFG-------EENIEVYHSFWWPLEWTHISRDNNKCYHKVWCNLRDY----CKV80 (198)
T 3KW2_A1SLPLF--YAPDI--EQSDRLPDDEAGHILRVLRMQAGDRLRLTDGRGSFFDAVIETADRKSCYVSVCGQESWQKPWRDRI80 (198)
T ss_pred1CCCEE--ECCCC--CCCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCCEEEEEEEECCCCEEEEEEEEEECCCCCCCCEE80 (198)
T ss_dssp1UCCEE--ECTTT--TTCSBCCHHHHHHHHTTSCCCTTCEEEEECSBSEEEEEEEEEECSSCEEEEEEEEEECCCSSCSCE80 (198)
Q ss_pred81EEEEEECCCCHHHHHHHHHHHHCCCC----------------HHCCCCCC--------CCCCCCCCEE------------160 (198)
Q d20180709_381VIGHVIKKNAGEVTEGFESALCCGLY----------------KQFLDSTI--------EWPPVLAEIF------------160 (198)
T 3KW2_A81TIAIAPTKQSERMEWMLEKLVEIGVDEVVFIESEHSERRRIKAERLERIAISAMKQSLKASFPVIRVNIPIQTVIADTPK160 (198)
T ss_pred81EEEEEEECCHHHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCCEECCCCCHHHHHHHCCC160 (198)
T ss_dssp81EEEECCCSSHHHHHHHHHHHHHHCCSEEEEEECTTSCCSCCCHHHHHHHHHHHHHHTTCSBCCEEEEEEEHHHHHHHSCT160 (198)
Q ss_pred161--EEEEEEECCCC---------------CCC-CCCCCC198 (198)
Q d20180709_3161--TWLSVTKQSGL---------------DQV-QASCFM198 (198)
T 3KW2_A161AAVRLIAYVDEAVRAEITQGRGYPSDFYHVGQDVLILI198 (198)
T ss_pred161CCCEEEEECCCCCCCCCCCCCCCCHHHCCCCCCEEEEE198 (198)
T ss_dssp161TSEEEEECCCTTCCUUUUUCCCCGGGTCCTTSCEEEEE198 (198)


No 6
> 1JTG_B        Alignment in PIR format
MAC score = 42.52	Identity = 0.15

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCEEEEECEEECCEEEEEEECCCCEEEEEEEECCCCC-CEEEEEEECCCC80 (168)
Q d20180709_31YRNVMPTNFTPLEYGCCILSEEKYVVKFGEENIEVYHSFWWPLEWTHISRDNNKCYHKVWCNLRDYC-KVVIGHVIKKNA80 (168)
T 1JTG_B1AGVMTGAKFTQ---IQFGMTRQQVLDIAGAENCETGGSFGDSIHCRGHAAGDYYAYATFGFTSAAADAKVDSKSQEKLLA80 (168)
T ss_pred1CCCCCHHHHHH---EECCCCHHHHHHHCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCC80 (168)
T ss_dssp1CCCCCHHHHHH---CCTTCBHHHHHHHHCGGGEECSGGGTTSEEEEEEEETTEEEEEEEEESSSSTTCBEEEEEEESSSC80 (168)
Q ss_pred81---HHHHHHHHHHHHCCCCHHCCCCCCCCCC------C-------CCCEE-------------------EEEEEEECCCC160 (168)
Q d20180709_381---GEVTEGFESALCCGLYKQFLDSTIEWPP------V-------LAEIF-------------------TWLSVTKQSGL160 (168)
T 1JTG_B81PSAPTLTLAKFNQVTVGMTRAQVLATVGQGSCTTWSEYYPAYPSTAGVTLSLSCFDVDGYSSTGFYRGSAHLWFTDGVLQ160 (168)
T ss_pred81CCCCEEEEEECCCEEECCEEEEEEEECCCCCCCCHHHHCCCCCCCCCEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEE160 (168)
T ss_dssp81CSBCCBCHHHHHHCCTTCBHHHHHHHHCTBSEEEEEEECTTTTSCTTCEEEEEEEBTTTCCSSSCCSSEEEEEEETTEEE160 (168)
Q ss_pred161CCCCCCCC168 (168)
Q d20180709_3161DQVQASCF168 (168)
T 1JTG_B161GKRQWDLV168 (168)
T ss_pred161CCEEECCC168 (168)
T ss_dssp161EEEEESCC168 (168)


No 7
> 2WIA_A        Alignment in PIR format
MAC score = 42.06	Identity = 0.08

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCEEEEECEEECCEEEEEEECCCCEEEEEEEECCC---------------80 (183)
Q d20180709_31YRNVMPTNFTPLEYGCCILSEEKYVVKFGEENIEVYHSFWWPLEWTHISRDNNKCYHKVWCNLRD---------------80 (183)
T 2WIA_A1MQK-----LTVGLIGNPNSGKTTLFNQLTGARQRVGNWAGVTVERKEGIFATTDHQVTLVDLPGTYSLTTISSQTSLDEQ80 (183)
T ss_pred1CCC-----CEEEEECCCCCCHHHHHHHHHCCCEEECCCCCCCEEEEEEEEEECCEEEEEEECCCCCCCCCCCHHHHHHHH80 (183)
T ss_dssp1CEE-----EEEEEECCTTSSHHHHHHHHHTTCEEEEECTTSCCEEEEEEEECSSEEEEEEECCCCSCCCUUUUCCCHHHH80 (183)
Q ss_pred81---------CCCEEEEEEECCCCHHHHHHHHHHHHCCCC-------HHCCCCCCCCCCC-CCCEEEEEEEEECCCC----160 (183)
Q d20180709_381---------YCKVVIGHVIKKNAGEVTEGFESALCCGLY-------KQFLDSTIEWPPV-LAEIFTWLSVTKQSGL----160 (183)
T 2WIA_A81IACHYILSGDADMLINVVDASNLERNLYLTLQLLELGIPCVVALNMLDIAEKQQVRIDIDALAARLGCPVIPLVSTRGRG160 (183)
T ss_pred81HHHHHHCCCCCCEEEEEEECCCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCC160 (183)
T ss_dssp81HHHHHHTTCCCSEEEEEEEGGGHHHHHHHHHHHHHHTCCEEEEEECHHHHHHTTCCCCHHHHHHHHTSCEEECUUUCCHH160 (183)
Q ss_pred161-------------CCCCCCC-CC183 (183)
Q d20180709_3161-------------DQVQASC-FM183 (183)
T 2WIA_A161IEALKIALDRHQANSDLELVHYP183 (183)
T ss_pred161HHHHHHHHHHHCCCCCCCCCCCC183 (183)
T ss_dssp161HHHHHHHHHHCCCCCCCCCSCCC183 (183)


No 8
> 1Y0B_A    Xanthine phosphoribosyltransferase; purine metabolism, STRU genomics, PSI, protein structure initative, midwest center structural genomics; HET: G4P; 1.80A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 2fxv_A*     Alignment in PIR format
MAC score = 41.43	Identity = 0.1

Download partial structureDownload full-length structure
Q ss_pred1CCCCC--CCC---------------------------CCCCCCCCC----CCCHHHHHHHHCCCCEEEEECEEEC----C80 (181)
Q d20180709_31YRNVM--PTN---------------------------FTPLEYGCC----ILSEEKYVVKFGEENIEVYHSFWWP----L80 (181)
T 1Y0B_A1GVVLSDQVLKVDSFLNHQIDPLLMQRIGDEFASRFAKDGITKIVTIESSGIAPAVMTGLKLGVPVVFARKHKSLTLTDNL80 (181)
T ss_pred1CCCCCCCEEEEHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCEEEEECCCCHHHHHHHHHHHCCCEEEEEECCCCCCCCCE80 (181)
T ss_dssp1CEEETTTEEECTTTTSSEECHHHHHHHHHHHHHHTTTTTCCEEEEETTTTHHHHHHHHHHHTCCEEEEBSSCCSSCCSSE80 (181)
Q ss_pred81EEEEEEECCCCEEEEEEEECC---CCCCEEEEEEECCCCHHHHHHHHHHHHCCCCHHCCCCCCCCCCCCCC--------E160 (181)
Q d20180709_381EWTHISRDNNKCYHKVWCNLR---DYCKVVIGHVIKKNAGEVTEGFESALCCGLYKQFLDSTIEWPPVLAE--------I160 (181)
T 1Y0B_A81LTASVYSFTKQTESQIAVSGTHLSDQDHVLIIDDFLANGQAAHGLVSIVKQAGASIAGIGIVIEKSFQPGRDELVKLGYR160 (181)
T ss_pred81EEEEEEEECCCCCEEEEEECCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEEEEEECCCCCHHHHHHHCCCC160 (181)
T ss_dssp81EEEEEEETTTTEEEEEEEEGGGCCTTCEEEEEEEEESSCHHHHHHHHHHHHTTCEEEEEEEEEEETTSTHHHHHHHTTCC160 (181)
Q ss_pred161EEEEEEEECCCCCCCCCCCCC181 (181)
Q d20180709_3161FTWLSVTKQSGLDQVQASCFM181 (181)
T 1Y0B_A161VESLARIQSL-EE-GKVSFVQ181 (181)
T ss_pred161EEEEEEECCC-CC-CCEEEEE181 (181)
T ss_dssp161EEEEEEEEEC-TT-TCCEECC181 (181)


No 9
> 2FXV_A        Alignment in PIR format
MAC score = 41.13	Identity = 0.1

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCC----CCCHHHHHHHHCCCCEEEEECEE-----ECCEEEEEEECCCCEEEEEEEEC---CCCCC80 (156)
Q d20180709_31YRNVMPTNFTPLEYGCC----ILSEEKYVVKFGEENIEVYHSFW-----WPLEWTHISRDNNKCYHKVWCNL---RDYCK80 (156)
T 2FXV_A1FAKDG-----ITKIVTIESSGIAPAVMTGLKLGVPVVFARKHKSLTLTDNLLTASVYSFTKQTE-SQIAVSGTHLSDQDH80 (156)
T ss_pred1HCCCC-----CCEEEEECCCCCHHHHHHHHHHCCCEEEEECCCCCCCCCCEEEEEEEEECCCCE-EEEEEEHHCCCCCCE80 (156)
T ss_dssp1TTTSC-----CCEEEEETTTTHHHHHHHHHHHTCCEEEEEEECCSSCCSSEEEEEEECTTTCCE-EEEEEEGGGCCTTCE80 (156)
Q ss_pred81EEEEEEECCCCHHHHHHHHHHHHCCCCHHCCCCCCCCCCCC-----------CCEEEEEEEEECCCCCCCCCCCCC156 (156)
Q d20180709_381VVIGHVIKKNAGEVTEGFESALCCGLYKQFLDSTIEWPPVL-----------AEIFTWLSVTKQSGLDQVQASCFM156 (156)
T 2FXV_A81VLIIDDFLANGQAAHGLVSIVKQAGASIAGIGIVIEKSFQPGRDELVKLGYRVESLARIQSLEEGKVS-FVQEVHS156 (156)
T ss_pred81EEEEEECCCCCHHHHHHHHHHHHCCCEEEEEEEEEECCCCCHHHHHHHCCCCEEEEEEEEEECCCEEE-EEEECCC156 (156)
T ss_dssp81EEEEEEEESSSHHHHHHHHHHHHTTCEEEEEEEEEEETTSTHHHHHGGGTCCEEEEEEEEECGGGCCE-ECCUUUU156 (156)


No 10
> 2AQ1_B        Alignment in PIR format
MAC score = 40.85	Identity = 0.14

Download partial structureDownload full-length structure
Q ss_pred1CCC-------CC-------CCCCCC--------CCCCCCCCCHHHHHHHHCCCCEEEEECEEECCE--------------80 (208)
Q d20180709_31YRN-------VM-------PTNFTP--------LEYGCCILSEEKYVVKFGEENIEVYHSFWWPLE--------------80 (208)
T 2AQ1_B1YDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVWWHGKT80 (208)
T ss_pred1HCCCEEEEEECCCCCCCCEEEEEECCCCCEEEECEEEEEEECCHHHHHHHCCCCEEEEEECCCCCEEEEEEEECCCCCEE80 (208)
T ss_dssp1HSSCCEEEEEECCCBCSSTTEEEEECCCSSSSSCSEEEEECSSHHHHHHHHTSCEEEEECCBCTTCCCCCSSCCTTSCEE80 (208)
Q ss_pred81--EE-EEEE--------CCCCEEEEEEEECCCCCCEEEEEEECCCCHHHHHHHHHHHHC----CCCHHCC-CCCCCCCCC160 (208)
Q d20180709_381--WT-HISR--------DNNKCYHKVWCNLRDYCKVVIGHVIKKNAGEVTEGFESALCC----GLYKQFL-DSTIEWPPV160 (208)
T 2AQ1_B81CMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTIS-FEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKF160 (208)
T ss_pred81EEEEEEEECCCCCCCCCEEEEEEEEECCCCEEEEC-EEEEEECCEEEEEEEEHHHHHHHHHHCCCCCCCCCCCCEEEEEE160 (208)
T ss_dssp81EEECCEEESTTCBCSTTCCEEEEEEEEETTEEEEE-EEEEESBSEEEHHHHHHHHHHHHHHHHCCSCSSCCSEEEEEEEE160 (208)
Q ss_pred161C---CCEEEEEEEEECCCC----------------CCC----CCCCCC208 (208)
Q d20180709_3161L---AEIFTWLSVTKQSGL----------------DQV----QASCFM208 (208)
T 2AQ1_B161IENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTT208 (208)
T ss_pred161EECCCCEEEEEEEECCCCCCCHHHEEEEECCCCEEECCEEEEEEEEEE208 (208)
T ss_dssp161ECTTSCEEEEECSCCSBSCCCHHHHHGGGGGCCEEETTTCEEEEEEEE208 (208)