TreeThreader - Results

  Job information

Job ID: d20180709
#Proteins: 4
Protein ID: d20180709_2
Fasta ID: seq2
Submission time: 2018-07-09 10:54:02 +0800
Finished time: 2019-02-17 15:13:44 +0800
Identical Job(s): NULL

  Alignments

1
50
100
133
2FXV_A 2FXV_A 1QB8_A 1QB8_A 1OSN_A 1OSN_A 1MZV_A 1MZV_A 1Y0B_A 1Y0B_A 3IE5_A 3IE5_A 1L1Q_A 1L1Q_A 3QFA_A 3QFA_A 1P4A_A 1P4A_A 1E09_A 1E09_A

  Build multi-template model (choose up to 5 templates)

                   
Download full-length structure

  Top 10 hits

Query:
Job ID  : d20180709_2
Length : 133
Sequence: AWNVPRFVFTPLEYECCLLSVQKAVESFGEENIEVIHSVMMLPEWTVKIRDNNKAYVKVICNLKDNERLVGFHVDGDNAK EVTCGFAAALVTVLTKQELDSTIGWFPVCAQKFGTKSVYWRSAGDILQGSWCG

No Hit MAC Score Identity Cols Query HMM Template HMM
12FXV_A46.990.061291-13348-193
21QB8_A42.520.061301-13369-226
31OSN_A42.40.111321-1339-195
41MZV_A420.081301-13370-222
51Y0B_A41.720.051301-13351-197
63IE5_A40.770.11211-1339-140
71L1Q_A39.890.041231-13351-186
83QFA_A38.820.651331-133146-519
91P4A_A38.740.051301-133128-270
101E09_A38.550.111221-1332-134

  Pairwise Query-Template Alignment

No 1
> 2FXV_A        Alignment in PIR format
MAC score = 46.99	Identity = 0.06

Download partial structureDownload full-length structure
Q ss_pred1CCCCCEEEECCCCCCCCCCCHHHHHHHCCCCCEEEEEEECC-----CCCEEEEECCCCCCEEEEEEEC---CCCCCEEEE80 (150)
Q d20180709_21AWNVPRFVFTPLEYECCLLSVQKAVESFGEENIEVIHSVMM-----LPEWTVKIRDNNKAYVKVICNL---KDNERLVGF80 (150)
T 2FXV_A1KDGITKIVTIES---SGIAPAVMTGLKLGVPVVFARKHKSLTLTDNLLTASVYSFTKQTE-SQIAVSGTHLSDQDHVLII80 (150)
T ss_pred1CCCCCEEEEECC---CCCHHHHHHHHHHCCCEEEEECCCCCCCCCCEEEEEEEEECCCCE-EEEEEEHHCCCCCCEEEEE80 (150)
T ss_dssp1TSCCCEEEEETT---TTHHHHHHHHHHHTCCEEEEEEECCSSCCSSEEEEEEECTTTCCE-EEEEEEGGGCCTTCEEEEE80 (150)
Q ss_pred81EEECCCCCHHHHHHHHHHHHCCCHHHHHCCCCCCCCC---------CCEEEEEEEEEECCCCCCCCCCCC150 (150)
Q d20180709_281HVDGDNAKEVTCGFAAALVTVLTKQELDSTIGWFPVC---------AQKFGTKSVYWRSAGDILQGSWCG150 (150)
T 2FXV_A81DDFLANGQAAHGLVSIVKQAGASIAGIGIVIEKSFQPGRDELVKLGYRVESLARIQSLEEGKVSFVQEVH150 (150)
T ss_pred81EECCCCCHHHHHHHHHHHHCCCEEEEEEEEEECCCCCHHHHHHHCCCCEEEEEEEEEECCCEEEEEEECC150 (150)
T ss_dssp81EEEESSSHHHHHHHHHHHHTTCEEEEEEEEEEETTSTHHHHHGGGTCCEEEEEEEEECGGGCCEECCUUU150 (150)


No 2
> 1QB8_A        Alignment in PIR format
MAC score = 42.52	Identity = 0.06

Download partial structureDownload full-length structure
Q ss_pred1CCCCCEEEECCCCCCCCCCCHHHHHHHCCCCCEEEEEEECCCC-CEEEEECCC------CCCEEEEEEECCCCCCEEEEE80 (161)
Q d20180709_21AWNVPRFVFTPLEYECCLLSVQKAVESFGEENIEVIHSVMMLP-EWTVKIRDN------NKAYVKVICNLKDNERLVGFH80 (161)
T 1QB8_A1SPAPTHILGFDA---RGFLFGPMIAVELEIPFVLMRKADKNAGLLIRSEPYEKEYKEAAPEVMTIRYGSIGKGSRVVLID80 (161)
T ss_pred1CCCCCEEEEECC---CCCHHHHHHHHHHCCCEEEEECCCCCCCCEEEEEEEEEEECCCCEEEEEEECCCCCCCCEEEEEE80 (161)
T ss_dssp1SSCCCEEEEETT---GGGGTHHHHHHHHTCCEEEEBCTTTCCSSEEECCCCCCCSSCCCCCCCEEETTSSCTTCEEEEEE80 (161)
Q ss_pred81EECCCCCHHHHHHHHHHHHCCCHHHHHCCCCCCCC--------------CCCEEEEEEEEEECCCCCCC-------CCCC160 (161)
Q d20180709_281VDGDNAKEVTCGFAAALVTVLTKQELDSTIGWFPV--------------CAQKFGTKSVYWRSAGDILQ-------GSWC160 (161)
T 1QB8_A81DVLATGGTALSGLQLVEASDAVVVEMVSILSIPFLKAAEKIHSTANSRYKDIKFISLLSDDALTEENCGDSKNYTGPRVL160 (161)
T ss_pred81CCCCCHHHHHHHHHHHHHCCCEEEEEEEEEECCCCCHHHHHHHCCCCEEEEEEEEEECCCCEEEHHHCCCCCHHHHHHHH160 (161)
T ss_dssp81EEESSCHHHHHHHHHHHHTTCEEEEEEEEEECGGGCHHHHHHHHHHHTTTTCCEEEEEEGGGCCGGGBCCCTTCCSCSCC160 (161)
Q ss_pred161C161 (161)
Q d20180709_2161G161 (161)
T 1QB8_A161S161 (161)
T ss_pred161H161 (161)
T ss_dssp161C161 (161)


No 3
> 1OSN_A    Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, transferase; HET: BVP ADP; 3.20A {Human herpesvirus 3} SCOP: c.37.1.1     Alignment in PIR format
MAC score = 42.4	Identity = 0.11

Download partial structureDownload full-length structure
Q ss_pred1CCCCCEEEECCCCCCCCCCCHHHHHHHCCCCCEEEEEEECCCCC-------------EEEE-ECCC---------CCCEE80 (188)
Q d20180709_21AWNVPRFVFTPLEYECCLLSVQKAVESFGEENIEVIHSVMMLPE-------------WTVK-IRDN---------NKAYV80 (188)
T 1OSN_A1KMGVLRIYLDGAYGIGKTTAAEEFLHHFAITPNRILLIGEPLSYWRNLAGEDAICGIYGTQTRRLNGDVSPEDAQRLTAH80 (188)
T ss_pred1CCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCHHCCCCCCCHHHHHHHHHH80 (188)
T ss_dssp1CEEEEEEEEEESSSSCTTHHHHHHHHTTTTSGGGEEEECCCHHHHTTBTTBCHHHHHHHHHHHHHTTSSCHHHHHHHHHH80 (188)
Q ss_pred81E--EEE--------------ECC--------CCCCEEEEEEECCCCCHHHHHHHHHHHHCCCHHHHHCCCCCCCCCCCEE160 (188)
Q d20180709_281K--VIC--------------NLK--------DNERLVGFHVDGDNAKEVTCGFAAALVTVLTKQELDSTIGWFPVCAQKF160 (188)
T 1OSN_A81FQSLFCSPHAIMHAKISALMDTSTSDLVQVNKEPYKIMLSDRHPIASTICFPLSRYLVGDMSPAALPGLLFTLPAEP-PG160 (188)
T ss_pred81HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEECCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCC-CC160 (188)
T ss_dssp81HHHHTHHHHHHHHHHHHHTSCCCCSCCSCCCSSCCEEEEEESCTHHHHTHHHHHHHHHTSSCGGGHHHHHTTCCCCC-SC160 (188)
Q ss_pred161EEEEEEEECCCCCCCC--------CCCC188 (188)
Q d20180709_2161GTKSVYWRSAGDILQG--------SWCG188 (188)
T 1OSN_A161TNLVVCTVSLPSHLSRVSKRARPGETVN188 (188)
T ss_pred161CCEEEEECCHHHHHHHHHHCCCCCCCCC188 (188)
T ss_dssp161CEEEEEECCHHHHHHHCCUUUUUUCCCC188 (188)


No 4
> 1MZV_A        Alignment in PIR format
MAC score = 42	Identity = 0.08

Download partial structureDownload full-length structure
Q ss_pred1CCCCCEEEECCCCCCCCCCCHHHHHHHCCCCCEEEEEEECCCC-CEEEEECCC------CCCEEEEEEECCCCCCEEEEE80 (156)
Q d20180709_21AWNVPRFVFTPLEYECCLLSVQKAVESFGEENIEVIHSVMMLP-EWTVKIRDN------NKAYVKVICNLKDNERLVGFH80 (156)
T 1MZV_A1SPAPTHILGFDA---RGFLFGPMIAVELGIPFVLMRKADKNAGLLIRSEPYEKEYKEAAPEVMTIRHGSIGKNSRVVLID80 (156)
T ss_pred1CCCCCEEEEECC---CCCHHHHHHHHHHCCCEEEEECCCCCCCCCEEEEEEEEECCCCEEEEEEEECCCCCCCCEEEEEE80 (156)
T ss_dssp1SSCCSEEEEETT---GGGGTHHHHHHHHTCCEEEEBCGGGCCSSEEECCCCCCCTTCCCCCCCEEETTSSCTTCEEEEEE80 (156)
Q ss_pred81EECCCCCHHHHHHHHHHHHCCCHHHHHCCCCCCCC--------------CCCEEEEEEEEEECCCCCCCCC--CCC156 (156)
Q d20180709_281VDGDNAKEVTCGFAAALVTVLTKQELDSTIGWFPV--------------CAQKFGTKSVYWRSAGDILQGS--WCG156 (156)
T 1MZV_A81DVLATGGTALSGLQLVEASGAEVVEMVSILTIPFLKAAERIHSTAGGRYKNVRFIGLLSEDVLTEANCGDLNDYTG156 (156)
T ss_pred81CCCCCHHHHHHHHHHHHHCCCEEEEEEEEEECCCCCHHHHHHHCCCCEEEEEEEECCCCCCEEEEEECCCCCCCCC156 (156)
T ss_dssp81EEESSSHHHHHHHHHHHHTTCEEEEEEEEEECGGGCHHHHHHHGGGGTTTTCCEEEEEEGGGCCGGGBCCCUUUUU156 (156)


No 5
> 1Y0B_A    Xanthine phosphoribosyltransferase; purine metabolism, STRU genomics, PSI, protein structure initative, midwest center structural genomics; HET: G4P; 1.80A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 2fxv_A*     Alignment in PIR format
MAC score = 41.72	Identity = 0.05

Download partial structureDownload full-length structure
Q ss_pred1CCCCCEEEECCCCCCCCCCCHHHHHHHCCCCCEEEEEEECCCC---CEEEEECCC-CCCEEEEEEECC---CCCCEEEEE80 (150)
Q d20180709_21AWNVPRFVFTPLEYECCLLSVQKAVESFGEENIEVIHSVMMLP---EWTVKIRDN-NKAYVKVICNLK---DNERLVGFH80 (150)
T 1Y0B_A1KDGITKIVTIE---SSGIAPAVMTGLKLGVPVVFARKHKSLTLTDNLLTASVYSFTKQTESQIAVSGTHLSDQDHVLIID80 (150)
T ss_pred1CCCCCEEEEEC---CCCHHHHHHHHHHHCCCEEEEEECCCCCCCCCEEEEEEEEECCCCCEEEEEECCCCCCCCEEEEEE80 (150)
T ss_dssp1TTTCCEEEEET---TTTHHHHHHHHHHHTCCEEEEBSSCCSSCCSSEEEEEEEETTTTEEEEEEEEGGGCCTTCEEEEEE80 (150)
Q ss_pred81EECCCCCHHHHHHHHHHHHCCCHHHHHCCCCCCCCCC---------CEEEEEEEEEECCCCCCCC-CCCC150 (150)
Q d20180709_281VDGDNAKEVTCGFAAALVTVLTKQELDSTIGWFPVCA---------QKFGTKSVYWRSAGDILQG-SWCG150 (150)
T 1Y0B_A81DFLANGQAAHGLVSIVKQAGASIAGIGIVIEKSFQPGRDELVKLGYRVESLARIQSLEEGKVSFVQEVHS150 (150)
T ss_pred81CCCCCCHHHHHHHHHHHHCCCEEEEEEEEEECCCCCHHHHHHHCCCCEEEEEEECCCCCCCEEEEEECCC150 (150)
T ss_dssp81EEESSCHHHHHHHHHHHHTTCEEEEEEEEEEETTSTHHHHHHHTTCCEEEEEEEEECTTTCCEECCCUUU150 (150)


No 6
> 3IE5_A    Phenolic oxidative coupling protein HYP-1; hypericin, ST JOHN'S WORT, depression, allergy, PR-10 protein, cytokinin, plant hormones; HET: PGE PG4 PE8 1PE; 1.69A {Hypericum perforatum} SCOP: d.129.3.0     Alignment in PIR format
MAC score = 40.77	Identity = 0.1

Download partial structureDownload full-length structure
Q ss_pred1CCCCCEEEECCCCC----CCCCCCHHHHHHHCCCCCEEEEEEECCC------CCEEEEECCC-CCCEEEEEEECCCCCCE80 (144)
Q d20180709_21AWNVPRFVFTPLEY----ECCLLSVQKAVESFGEENIEVIHSVMML------PEWTVKIRDN-NKAYVKVICNLKDNERL80 (144)
T 3IE5_A1AYTIVKEEESPIAPHRLFKALVLERHQVLVKAQPHVFKSGEIIEGDGGVGTVTKITFVDGHPLTYMLHKFDEIDAANFYC80 (144)
T ss_pred1EEEEEEEEEECCCHHHHHHHHHCCHHHHHHHHCHHHCCEEEEECCCCCCCEEEEEEECCCCCCEEEEEEEEEECCCCCEE80 (144)
T ss_dssp1CEEEEEEEEESSCHHHHHHHHTTTHHHHHHHHCTTTEEEEEEEESSSSTTCEEEEEECTTSSCCEEEEEEEEEEGGGTEE80 (144)
Q ss_pred81EEEEEECCCCCHHHHHHHHHHHHCCCHHHHHCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCC144 (144)
Q d20180709_281VGFHVDGDNAKEVTCGFAAALVTVLTKQELDSTIGWFPVCAQKFGTKSVYWRSAGDILQGSWCG144 (144)
T 3IE5_A81KYTLFEGDVLRDNIEKVVYEV--K-----LEA----VGGG-SKGKITVTYHPKPGCTVNEEEVK144 (144)
T ss_pred81EEEEECCCCCCCCCCEEEEEE--E-----EEE----CCCC-EEEEEEEEEEECCCCCCCHHHHH144 (144)
T ss_dssp81EEEEEEEGGGTTTEEEEEEEE--E-----EEE----ETTE-EEEEEEEEEEECTTCCCCHHHHH144 (144)


No 7
> 1L1Q_A    Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, cataly transferase; HET: 9DA; 1.85A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1l1r_A*     Alignment in PIR format
MAC score = 39.89	Identity = 0.04

Download partial structureDownload full-length structure
Q ss_pred1CCCCCEEEECCCCCCCCCCCHHHHHHHCCCCCEEEEEEECCC-CCEEEEECCCCCCEEEEEEECC---CCCCEEEEEEEC80 (146)
Q d20180709_21AWNVPRFVFTPLEYECCLLSVQKAVESFGEENIEVIHSVMML-PEWTVKIRDNNKAYVKVICNLK---DNERLVGFHVDG80 (146)
T 1L1Q_A1DVPITKVVGIE-S--RGFILGGIVANSLGVGFVALRKAGKLPGDVCKCTFDMEYQKGVTIEVQKRQLGPHDVVLLHDDVL80 (146)
T ss_pred1CCCCCEEEEEC-C--CCHHHHHHHHHHHCCCEEEEEECCCCCCCEEEEEEEHHHCCCEEEEEECCCCCCCCEEEEECCCC80 (146)
T ss_dssp1TSCCCEEEEES-G--GGHHHHHHHHHHHTCEEEEEEETTSSCSSEEEEEEEETTEEEEEEEEEGGGCCTTCCEEEEEEEE80 (146)
Q ss_pred81CCCCHHHHHHHHHHHHCCCHHHHHCCCCCCCCCC-------C--EEEEEEEEEECCCCCCCCCCCC146 (146)
Q d20180709_281DNAKEVTCGFAAALVTVLTKQELDSTIGWFPVCA-------Q--KFGTKSVYWRSAGDILQGSWCG146 (146)
T 1L1Q_A81ATGGTLLAAIELCETAGVKPENIYINVLYEIEALKGREKVGQKCTRLFSVIRE--HH-----HHHH146 (146)
T ss_pred81CCHHHHHHHHHHHHHCCCEEEEEEEEEEEECCCCCHHHHCCCCCEEEEEEEHH--HC-----CCCC146 (146)
T ss_dssp81SSSHHHHHHHHHHHHTTCCGGGEEEEEEEECGGGCHHHHHTTTCCCEEEEEEC--CC-----UUUU146 (146)


No 8
> 3QFA_A    Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A*     Alignment in PIR format
MAC score = 38.82	Identity = 0.65

Download partial structureDownload full-length structure
Q ss_pred1C-C-----------------------------------------------------------------------------80 (374)
Q d20180709_21A-W-----------------------------------------------------------------------------80 (374)
T 3QFA_A1VYENAYGQFIGPHRIKATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALEC80 (374)
T ss_pred1EEEEEEEEECCCCEEEEEECCCCEEEEEECEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCEEEEECCCHHHHHH80 (374)
T ss_dssp1EEECSEEEEEETTEEEEECTTCCCCEEEEEEEEECCCEEECCCCCTTHHHHCBCHHHHTTCSSCCCSEEEECCSHHHHHH80 (374)
Q ss_pred81--------------------------------------------------------------------------------160 (374)
Q d20180709_281--------------------------------------------------------------------------------160 (374)
T 3QFA_A81AGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGEYN160 (374)
T ss_pred81HHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCEEEECCEEEEEEECCCCCCEEEEEEEEECCCCCEEEEECC160 (374)
T ss_dssp81HHHHHHTTCCEEEEESSCSSTTSCHHHHHHHHHHHHHTTCEEEESEEEEEEEEEECCTTCEEEEEEEESSSSCEEEEEES160 (374)
Q ss_pred161--------------------------------------------------------------------------------240 (374)
Q d20180709_2161--------------------------------------------------------------------------------240 (374)
T 3QFA_A161TVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGRLLAQRLYAGSTVKC240 (374)
T ss_pred161EEEEEECCCCCCCCCCCHHCCCEECCCCCCEEECCCCCCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCC240 (374)
T ss_dssp161EEEECSCEEESCSSSCSTTTTCCCCTTTCCBCCCTTSBCSSTTEEECGGGBSSSCCCHHHHHHHHHHHHHHHHSCCCCCC240 (374)
Q ss_pred241---CCCEEEECCCCCCCCCCCHHHHHHHCCCCCEEEEEEECCCCCEEEEECCCCCCEEEEEEECCCCCCEEEEEEECCCC320 (374)
Q d20180709_2241---NVPRFVFTPLEYECCLLSVQKAVESFGEENIEVIHSVMMLPEWTVKIRDNNKAYVKVICNLKDNERLVGFHVDGDNA320 (374)
T 3QFA_A241DYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNA320 (374)
T ss_pred241CCCCCCEEEECCCCEEEEECCHHHHHHHCCCCCEEEEEEECCCHHHHHHCCCCCCEEEEEEEECCCCCEEEEEEEECCCH320 (374)
T ss_dssp241CCTTCCEEECSSSCEEEEECCHHHHHHHHCGGGEEEEEEEECCHHHHTTTCCTTTEEEEEEEETTTTCEEEEEEEESTTH320 (374)
Q ss_pred321CHHHHHHHHHHHHCCCHHHHHCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCC374 (374)
Q d20180709_2321KEVTCGFAAALVTVLTKQELDSTIGWFPVCAQKFGTKSVYWRSAGDILQGSWCG374 (374)
T 3QFA_A321GEVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGSCG374 (374)
T ss_pred321HHHHHHHHHHHHCCCCHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCHHHCCCCC374 (374)
T ss_dssp321HHHHHHHHHHHHTTCBHHHHHHSCCCTTCGGGGGGGCCCBTTTTCCCCCCCTTC374 (374)


No 9
> 1P4A_A        Alignment in PIR format
MAC score = 38.74	Identity = 0.05

Download partial structureDownload full-length structure
Q ss_pred1CCCCCEEEECCCCCCCCCCCHHHHHHHCCCCCEEEEEEECCCC--CEEEEECCC-CCCEEEEEEECC---CCCCEEEEEE80 (146)
Q d20180709_21AWNVPRFVFTPLEYECCLLSVQKAVESFGEENIEVIHSVMMLP--EWTVKIRDN-NKAYVKVICNLK---DNERLVGFHV80 (146)
T 1P4A_A1EREI-DVVMTVAT--KGIPLAYAAASYLNVPVVIVRKDNKVTEGSTVSINYVSGSSNRIQTMSLAKRSMKTGSNVLIIDD80 (146)
T ss_pred1CCCC-CEEEEECC--CCHHHHHHHHHHHCCCEEEEECCCCCCCCCEEEEEEECCCCCCEEEEEEECCCCCCCCEEEEEEC80 (146)
T ss_dssp1TSCC-SEEEEESS--TTHHHHHHHHHHHTCCEEEEBCCUUUUUUCEEEEEEECTTCSSEEEEEEEGGGSCTTCEEEEEEE80 (146)
Q ss_pred81ECCCCCHHHHHHHHHHHHCCCHHHHHCCCCCCCC---C-CCEEEEEEEEEECCCCC---CCCCCCC146 (146)
Q d20180709_281DGDNAKEVTCGFAAALVTVLTKQELDSTIGWFPV---C-AQKFGTKSVYWRSAGDI---LQGSWCG146 (146)
T 1P4A_A81FMKAGGTINGMINLLDEFNANVAGIGVLVEAEGVDERLVDEYMSLLTLSTINMKEKSIEIQNGNFL146 (146)
T ss_pred81CCCCHHHHHHHHHHHHHCCCEEEEEEEEEECCCCCCHHHHCCCCEEEEEEEEECCCCEEEECCCCC146 (146)
T ss_dssp81EESSSHHHHHHHHHHHHTTCEEEEEEEEEEESCCSSCCSSCCEEEEEECCSCSSSSCCCEEECSGG146 (146)


No 10
> 1E09_A        Alignment in PIR format
MAC score = 38.55	Identity = 0.11

Download partial structureDownload full-length structure
Q ss_pred1CCCCCEEEECCCCC----CCCCCCHHHHHHHCCCCCEEEEEEECCC-----CCEEEEECCCCCCEEEEEEECCCC-CCEE80 (144)
Q d20180709_21AWNVPRFVFTPLEY----ECCLLSVQKAVESFGEENIEVIHSVMML-----PEWTVKIRDNNKAYVKVICNLKDN-ERLV80 (144)
T 1E09_A1VFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSIDKENYSY80 (144)
T ss_pred1CEEEEEEEEEECCHHHHHHHHHCCHHHHHHHHCCCCCCEEEEEECCCCCCEEEEEEECCCCCCEEEEEEEEEECCCCCEE80 (144)
T ss_dssp1EEEEEEEEEESSCHHHHHHHHTTTHHHHHHHHCTTTEEEEEEEESSSSTTCEEEEEECCSSSCEEEEEEEEEEETTTTEE80 (144)
Q ss_pred81EEEEE-CCCCCHHHHHHHHHHHHCCCHHHHHCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCC144 (144)
Q d20180709_281GFHVD-GDNAKEVTCGFAAALVTVLTKQELDSTIGWFPVCAQKFGTKSVYWRSAGDILQGSWCG144 (144)
T 1E09_A81SYTLIEGDALGDTLEKISY--ET-----KLVA----SPSGGSIIKSTSHYHTKGNVEIKEEHVK144 (144)
T ss_pred81EEEEEECCCCCCCEEEEEE--EE-----EEEE----CCCCCCEEEEEEEEEECCCCCCCHHHHH144 (144)
T ss_dssp81EEEECCCTTTGGGEEEEEE--EE-----EECC----CTTSSEEEEEEEEEEECSSCCCCHHHHH144 (144)