TreeThreader - Results

  Job information

Job ID: d20180709
#Proteins: 4
Protein ID: d20180709_1
Fasta ID: seq1
Submission time: 2018-07-09 10:54:02 +0800
Finished time: 2019-02-17 15:13:38 +0800
Identical Job(s): NULL

  Alignments

1
50
100
133
3EAO_A 3EAO_A 1H6V_A 1H6V_A 3QFA_A 3QFA_A 1ZDL_A 1ZDL_A 2ZZ0_A 2ZZ0_A 2J3N_A 2J3N_A 2CFY_A 2CFY_A 2NVK_X 2NVK_X 3DGZ_A 3DGZ_A 3H4K_A 3H4K_A

  Build multi-template model (choose up to 5 templates)

                   
Download full-length structure

  Top 10 hits

Query:
Job ID  : d20180709_1
Length : 133
Sequence: NDNFYCTVFTPSEYGCRCLSESKAMKKIGEENIPVYHPFTWPYVWTVPSQSNGKCYTHVILNLKDEERFVGFHVLGPNAG EVTVEASCALKCGITKPQLTSTIGIHPVCAEIFTTLSVTKIPVGDILQSPCCP

No Hit MAC Score Identity Cols Query HMM Template HMM
13EAO_A97.790.721331-133367-499
21H6V_A97.690.721331-133367-499
33QFA_A97.410.641331-133387-519
41ZDL_A96.930.381331-133385-517
52ZZ0_A93.020.651331-133381-513
62J3N_A92.460.651331-133387-519
72CFY_A90.130.641331-133389-521
82NVK_X88.830.381301-130359-488
93DGZ_A86.290.371301-133359-488
103H4K_A85.280.461331-133466-598

  Pairwise Query-Template Alignment

No 1
> 3EAO_A        Alignment in PIR format
MAC score = 97.79	Identity = 0.72

Download partial structureDownload full-length structure
Q ss_pred1CCCCCEEEECCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCEEEEEEECCCHH80 (133)
Q d20180709_11NDNFYCTVFTPSEYGCRCLSESKAMKKIGEENIPVYHPFTWPYVWTVPSQSNGKCYTHVILNLKDEERFVGFHVLGPNAG80 (133)
T 3EAO_A1YDNVPTTVFTPLEYGCCGLSEEKAVEKFGEENIEVYHSFFWPLEWTVPSRDNNKCYAKVICNLKDNERVVGFHVLGPNAG80 (133)
T ss_pred1CHHCCEEEECCCCCEEECCCHHHHHHHCCCCCEEEEEECCCCCEEEHHCCCCCCCEEEEEEECCCCCEEEEEEEECCCHH80 (133)
T ss_dssp1CTTCCEEECCSSCEEEEECCHHHHHHHHCGGGEEEEEEEECCHHHHTTTCCTTCEEEEEEEEGGGTSEEEEEEEESTTHH80 (133)
Q ss_pred81HHHHHHHHHHHCCCCHHHHHCCCCCCCCCHHHEEEEEEEECCCCCCCCCCCCC133 (133)
Q d20180709_181EVTVEASCALKCGITKPQLTSTIGIHPVCAEIFTTLSVTKIPVGDILQSPCCP133 (133)
T 3EAO_A81EVTQGFAAALKCGLTKQQLDSTIGIHPVCAEIFTTLSVTKRSGGDILQSGCCG133 (133)
T ss_pred81HHHHHHHHHHHCCCCHHHHHCCCCCCCCHHHHHHHHHCCHHCCCCCCCCCCCC133 (133)
T ss_dssp81HHHHHHHHHHHTTCBHHHHHHSCCCTTCGGGGGGGCCCBSTTCCCCCCCCSCC133 (133)


No 2
> 1H6V_A        Alignment in PIR format
MAC score = 97.69	Identity = 0.72

Download partial structureDownload full-length structure
Q ss_pred1CCCCCEEEECCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCEEEEEEECCCHH80 (133)
Q d20180709_11NDNFYCTVFTPSEYGCRCLSESKAMKKIGEENIPVYHPFTWPYVWTVPSQSNGKCYTHVILNLKDEERFVGFHVLGPNAG80 (133)
T 1H6V_A1YDNVPTTVFTPLEYGCCGLSEEKAVEKFGEENIEVYHSFFWPLEWTVPSRDNNKCYAKVICNLKDNERVVGFHVLGPNAG80 (133)
T ss_pred1HHHCCEEEECCCCCEEECCCHHHHHHHCCCCCEEEEEECCCCCEEEHHCCCCCCCEEEEEEECCCCCEEEEEEEECCCHH80 (133)
T ss_dssp1CSSCCEEECSSSCEEEEECCHHHHHHHHCGGGEEEEEEEECCHHHHTTTCCTTCEEEEEEEEGGGTTEEEEEEEESTTHH80 (133)
Q ss_pred81HHHHHHHHHHHCCCCHHHHHCCCCCCCCCHHHEEEEEEEECCCCCCCCCCCCC133 (133)
Q d20180709_181EVTVEASCALKCGITKPQLTSTIGIHPVCAEIFTTLSVTKIPVGDILQSPCCP133 (133)
T 1H6V_A81EVTQGFAAALKCGLTKQQLDSTIGIHPVCAEIFTTLSVTKRSGGDILQSGCCG133 (133)
T ss_pred81HHHHHHHHHHHCCCCHHHHHCCCCCCCCHHHHHHHHHHHHHCCCCCEECCCCC133 (133)
T ss_dssp81HHHHHHHHHHHTTCBHHHHHHSCCCTTCGGGGGGGCCCBGGGCCCCCCCSCCC133 (133)


No 3
> 3QFA_A    Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A*     Alignment in PIR format
MAC score = 97.41	Identity = 0.64

Download partial structureDownload full-length structure
Q ss_pred1CCCCCEEEECCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCEEEEEEECCCHH80 (133)
Q d20180709_11NDNFYCTVFTPSEYGCRCLSESKAMKKIGEENIPVYHPFTWPYVWTVPSQSNGKCYTHVILNLKDEERFVGFHVLGPNAG80 (133)
T 3QFA_A1YENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAG80 (133)
T ss_pred1CCCCCEEEECCCCEEEEECCHHHHHHHCCCCCEEEEEEECCCHHHHHHCCCCCCEEEEEEEECCCCCEEEEEEEECCCHH80 (133)
T ss_dssp1CTTCCEEECSSSCEEEEECCHHHHHHHHCGGGEEEEEEEECCHHHHTTTCCTTTEEEEEEEETTTTCEEEEEEEESTTHH80 (133)
Q ss_pred81HHHHHHHHHHHCCCCHHHHHCCCCCCCCCHHHEEEEEEEECCCCCCCCCCCCC133 (133)
Q d20180709_181EVTVEASCALKCGITKPQLTSTIGIHPVCAEIFTTLSVTKIPVGDILQSPCCP133 (133)
T 3QFA_A81EVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGSCG133 (133)
T ss_pred81HHHHHHHHHHHCCCCHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCHHHCCCCC133 (133)
T ss_dssp81HHHHHHHHHHHTTCBHHHHHHSCCCTTCGGGGGGGCCCBTTTTCCCCCCCTTC133 (133)


No 4
> 1ZDL_A        Alignment in PIR format
MAC score = 96.93	Identity = 0.38

Download partial structureDownload full-length structure
Q ss_pred1CCCCCEEEECCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCEEEEEEECCCHH80 (133)
Q d20180709_11NDNFYCTVFTPSEYGCRCLSESKAMKKIGEENIPVYHPFTWPYVWTVPSQSNGKCYTHVILNLKDEERFVGFHVLGPNAG80 (133)
T 1ZDL_A1YSNVPTTVFTPLEYGCVGLSEEEAVALHGQEHVEVYHAYYKPLEFTVADRDASQCYIKMVCMREPPQLVLGLHFLGPNAG80 (133)
T ss_pred1HHHCCEEEECCCCCEEECCCHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCCEEEEEEEECCCCCEEEEEEEECCCHH80 (133)
T ss_dssp1CTTCCEEECSSSEEEEEECCHHHHHHHHCGGGEEEEEEECCCHHHHHTTCCCTTCEEEEEEESSTTCBEEEEEEEETTHH80 (133)
Q ss_pred81HHHHHHHHHHHCCCCHHHHHCCCCCCCCCHHHEEEEEEEECCCCCCCCCCCCC133 (133)
Q d20180709_181EVTVEASCALKCGITKPQLTSTIGIHPVCAEIFTTLSVTKIPVGDILQSPCCP133 (133)
T 1ZDL_A81EVTQGFALGIKCGASYAQVMQTVGIHPTCSEEVVKLHISKRSGLEPTVTGCCG133 (133)
T ss_pred81HHHHHHHHHHHCCCCHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCC133 (133)
T ss_dssp81HHHHHHHHHHHHTCBHHHHHSSCCCSSCSGGGGGGCCCBTTTTCCCBCCCUUU133 (133)


No 5
> 2ZZ0_A        Alignment in PIR format
MAC score = 93.02	Identity = 0.65

Download partial structureDownload full-length structure
Q ss_pred1CCCCCEEEECCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCEEEEEEECCCHH80 (133)
Q d20180709_11NDNFYCTVFTPSEYGCRCLSESKAMKKIGEENIPVYHPFTWPYVWTVPSQSNGKCYTHVILNLKDEERFVGFHVLGPNAG80 (133)
T 2ZZ0_A1YENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAG80 (133)
T ss_pred1HHHCCEEEECCCCCEEECCCHHHHHHHCCCCCEEEEEECCCCEEEEECCCCCCCCEEEEEEECCCCCEEEEEEEECCCHH80 (133)
T ss_dssp1CTTCCEEECSSSCEEEEECCHHHHHHHHCGGGEEEEEEEECCGGGTTTTCCTTCEEEEEEEEGGGTTEEEEEEEESTTHH80 (133)
Q ss_pred81HHHHHHHHHHHCCCCHHHHHCCCCCCCCCHHHEEEEEEEECCCCCCCCCCCCC133 (133)
Q d20180709_181EVTVEASCALKCGITKPQLTSTIGIHPVCAEIFTTLSVTKIPVGDILQSPCCP133 (133)
T 2ZZ0_A81EVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGCCG133 (133)
T ss_pred81HHHHHHHHHHHCCCCHHHHHCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCC133 (133)
T ss_dssp81HHHHHHHHHHTTTCBHHHHHTSCCCTTCGGGGGTTCCCBTTTCCCCCCCSSCC133 (133)


No 6
> 2J3N_A        Alignment in PIR format
MAC score = 92.46	Identity = 0.65

Download partial structureDownload full-length structure
Q ss_pred1CCCCCEEEECCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCEEEEEEECCCHH80 (133)
Q d20180709_11NDNFYCTVFTPSEYGCRCLSESKAMKKIGEENIPVYHPFTWPYVWTVPSQSNGKCYTHVILNLKDEERFVGFHVLGPNAG80 (133)
T 2J3N_A1YENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAG80 (133)
T ss_pred1HHHCCEEEECCCCCEEECCCHHHHHHHCCCCCEEEEEECCCCEEEEECCCCCCCCEEEEEEECCCCCEEEEEEEECCCHH80 (133)
T ss_dssp1CTTCCEEECSSSCEEEEECCHHHHHHHHCGGGEEEEEEEECCGGGTTTTCCCSCEEEEEEEEGGGTTEEEEEEEESTTHH80 (133)
Q ss_pred81HHHHHHHHHHHCCCCHHHHHCCCCCCCCCHHHEEEEEEEECCCCCCCCCCCCC133 (133)
Q d20180709_181EVTVEASCALKCGITKPQLTSTIGIHPVCAEIFTTLSVTKIPVGDILQSPCCP133 (133)
T 2J3N_A81EVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGCCG133 (133)
T ss_pred81HHHHHHHHHHHCCCCHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCC133 (133)
T ss_dssp81HHHHHHHHHHTTTCBHHHHHTSCCCTTCSGGGGGGCCCBTTTTCCCCCCUUUU133 (133)


No 7
> 2CFY_A        Alignment in PIR format
MAC score = 90.13	Identity = 0.64

Download partial structureDownload full-length structure
Q ss_pred1CCCCCEEEECCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCEEEEEEECCCHH80 (133)
Q d20180709_11NDNFYCTVFTPSEYGCRCLSESKAMKKIGEENIPVYHPFTWPYVWTVPSQSNGKCYTHVILNLKDEERFVGFHVLGPNAG80 (133)
T 2CFY_A1YENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAG80 (133)
T ss_pred1HHHCCEEEECCCCCEEECCCHHHHHHHCCCCCEEEEEECCCCEEEEECCCCCCCCEEEEEEECCCCCEEEEEEEECCCHH80 (133)
T ss_dssp1CSSCCEEECSSSCEEEEECCHHHHHHHHCGGGEEEEEEEECCGGGTTTTCCTTCEEEEEEEEGGGTTEEEEEEEESTTHH80 (133)
Q ss_pred81HHHHHHHHHHHCCCCHHHHHCCCCCCCCCHHHEEEEEEEECCCCCCCCCCCCC133 (133)
Q d20180709_181EVTVEASCALKCGITKPQLTSTIGIHPVCAEIFTTLSVTKIPVGDILQSPCCP133 (133)
T 2CFY_A81EVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGCGG133 (133)
T ss_pred81HHHHHHHHHHHCCCCHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCC133 (133)
T ss_dssp81HHHHHHHHHHHTTCBHHHHHHSCCCTTCGGGGGGSCCCBTTTCCCCCUUUUUU133 (133)


No 8
> 2NVK_X        Alignment in PIR format
MAC score = 88.83	Identity = 0.38

Download partial structureDownload full-length structure
Q ss_pred1CCCCCEEEECCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCEEEEEEECCCHH80 (130)
Q d20180709_11NDNFYCTVFTPSEYGCRCLSESKAMKKIGEENIPVYHPFTWPYVWTVPSQSNGKCYTHVILNLKDEERFVGFHVLGPNAG80 (130)
T 2NVK_X1YKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAG80 (130)
T ss_pred1CHHCCEEEECCCCCEEECCCHHHHHHHCCCCCEEEEECCCCHHHHHHCCCCCCCEEEEEEEECCCCCEEEEEEEECCCHH80 (130)
T ss_dssp1CSSCCEEECSSSEEEEEECCHHHHHHHHCGGGEEEEEEECCCGGGTTTTCCCTTCEEEEEEESSTTCBEEEEEEEETTHH80 (130)
Q ss_pred81HHHHHHHHHHHCCCCHHHHHCCCCCCCCCHHHEEEEEEEECCCCCCCCCC130 (130)
Q d20180709_181EVTVEASCALKCGITKPQLTSTIGIHPVCAEIFTTLSVTKIPVGDILQSP130 (130)
T 2NVK_X81EVIQGFAAALKSGLTINTLINTVGIHPTTAEEFTRLAITKRSGLDPTPAS130 (130)
T ss_pred81HHHHHHHHHHHCCCCHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCCCCCC130 (130)
T ss_dssp81HHHHHHHHHHHTTCBHHHHHHSCCCSSCSGGGGGGCCCBTTTTCCSSCCC130 (130)


No 9
> 3DGZ_A    Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A*     Alignment in PIR format
MAC score = 86.29	Identity = 0.37

Download partial structureDownload full-length structure
Q ss_pred1CCCCCEEEECCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCEEEEEEECCCHH80 (133)
Q d20180709_11NDNFYCTVFTPSEYGCRCLSESKAMKKIGEENIPVYHPFTWPYVWTVPSQSNGKCYTHVILNLKDEERFVGFHVLGPNAG80 (133)
T 3DGZ_A1YSNVPTTVFTPLEYGCVGLSEEEAVALHGQEHVEVYHAYYKPLEFTVADRDASQCYIKMVCMREPPQLVLGLHFLGPNAG80 (133)
T ss_pred1CCCCCEEEECCCCEEEEECCHHHHHHHCCCCCEEEEEECCCCHHHHHHCCCCCCEEEEEEEECCCCCEEEEEEEECCCHH80 (133)
T ss_dssp1CTTCCEEECSSSEEEEEECCHHHHHHHHCGGGEEEEEEECCCHHHHHTTCCCTTCEEEEEEESSTTCBEEEEEEEETTHH80 (133)
Q ss_pred81HHHHHHHHHHHCCCCHHHHHCCCCCCCCCHHHEEEEEEEECCCCCCCCCCCCC133 (133)
Q d20180709_181EVTVEASCALKCGITKPQLTSTIGIHPVCAEIFTTLSVTKIPVGDILQSPCCP133 (133)
T 3DGZ_A81EVTQGFALGIKCGASYAQVMQTVGIHPTCSEEVVKLHISKRSGLEP---TVTG133 (133)
T ss_pred81HHHHHHHHHHHCCCCHHHHHCCCCCCCCHHHHHHHHHHHHHCCCCC---CCCC133 (133)
T ss_dssp81HHHHHHHHHHHTTCBHHHHHTSCCCSSCSTHHHHTCCEETTTTCCC---CUUU133 (133)


No 10
> 3H4K_A        Alignment in PIR format
MAC score = 85.28	Identity = 0.46

Download partial structureDownload full-length structure
Q ss_pred1CCCCCEEEECCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCEEEEEEECCCHH80 (133)
Q d20180709_11NDNFYCTVFTPSEYGCRCLSESKAMKKIGEENIPVYHPFTWPYVWTVPSQSNGKCYTHVILNLKDEERFVGFHVLGPNAG80 (133)
T 3H4K_A1YSNVATTVFTPLEYGACGLSEEDAIEKYGDKDIEVYHSNFKPLEWTVAHREDNVCYMKLVCRKSDNMRVLGLHVLGPNAG80 (133)
T ss_pred1HHHCCEEEECCCCCEEECCCHHHHHHHHCCCCEEEEEEECCCCHHHCCCCCCCCCEEEEEEECCCCCEEEEEEEECCCHH80 (133)
T ss_dssp1CTTCCEEECSSSCEEEEECCHHHHHHHHCGGGEEEEEEEECCTHHHHTTCCTTCEEEEEEEETTTTTEEEEEEEESTTHH80 (133)
Q ss_pred81HHHHHHHHHHHCCCCHHHHHCCCCCCCCCHHHEEEEEEEECCCCCCCCCCCCC133 (133)
Q d20180709_181EVTVEASCALKCGITKPQLTSTIGIHPVCAEIFTTLSVTKIPVGDILQSPCCP133 (133)
T 3H4K_A81EITQGYAVAIKMGATKADFDRTIGIHPTCSETFTTLHVTKKSGVSPIVSGCCG133 (133)
T ss_pred81HHHHHHHHHHHCCCCHHHHHCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCC133 (133)
T ss_dssp81HHHHHHHHHHHHTCBHHHHHSSCCCTTCSGGGGGSCCCBTTTCCCCCCUUUUU133 (133)