TreeThreader - Results

  Job information

Job ID: d20180514
#Proteins: 4
Protein ID: d20180514_4
Fasta ID: seq4
Submission time: 2018-05-14 10:54:03 +0800
Finished time: 2018-05-14 14:34:25 +0800
Identical Job(s): NULL

  Alignments

1
50
100
150
200
250
274
3A8I_A 3A8I_A 3A8K_A 3A8K_A 1VLO_A 1VLO_A 1WOS_A 1WOS_A 1YX2_A 1YX2_A 1WSV_A 1WSV_A 3GIR_A 3GIR_A 1V5V_A 1V5V_A 2GAH_A 2GAH_A 1VRQ_A 1VRQ_A

  Build multi-template model (choose up to 5 templates)

                   
Download full-length structure

  Top 10 hits

Query:
Job ID  : d20180514_4
Length : 274
Sequence: NWWMYPCHTLWEARRVDHHGWIGPLHYGSQIDEHQATRTDAGTFPVAWRTIVKLRTSRTREFLRYLPANDPAKLTKSGKA LSSGGLRASGGVMSDLIVMSFTEVFFRWSVNGADRKKDLSWITQHACPFGINIWIRDDLKFHAVQGPNIYAKAATMFNKA QRWAVDGCKPFFGVQAGDLFDATTGYQGEAGSEIDLPNEKAFWFWHALVEAGGKFCGRAARDTLYLLAGANLYGCMWDEP IGPLAANGGITIPWEPAIMDFCGREATEMGVEHG

No Hit MAC Score Identity Cols Query HMM Template HMM
13A8I_A208.960.662741-2744-363
23A8K_A208.290.652741-2744-363
31VLO_A207.850.672741-27416-372
41WOS_A187.420.252731-2743-359
51YX2_A187.090.262721-2747-361
61WSV_A173.740.252731-2747-371
73GIR_A170.710.272671-27435-389
81V5V_A170.470.232721-2747-394
92GAH_A169.770.182721-274576-960
101VRQ_A167.640.192711-274575-959

  Pairwise Query-Template Alignment

No 1
> 3A8I_A        Alignment in PIR format
MAC score = 208.96	Identity = 0.66

Download partial structureDownload full-length structure
Q ss_pred1CCCCCHHHHHCCCEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCEEEEEECCCHHHHHCCCCCCCCCCCCCCCCE80 (360)
Q d20180514_41NWWMYPCHTLWEARRVDHHGWIGPLHYGSQIDEHQATRTDAGTFPVAWRTIVKLRTSRTREFLRYLPANDPAKLTKSGKA80 (360)
T 3A8I_A1QTPLYEQHTLCGARMVDFHGWMMPLHYGSQIDEHHAVRTDAGMFDVSHMTIVDLRGSRTREFLRYLLANDVAKLTKSGKA80 (360)
T ss_pred1CCCCHHHHHHCCCEEEEECCEECCCCCCCHHHHHHHHHHCCEEEECCCCEEEEEECCCHHHHHHHHCCCCHHHCCCCCEE80 (360)
T ss_dssp1CCTTHHHHHHTTCEEEECSSBEEEEESSCHHHHHHHHHHSCEEEECTTSEEEEEESTTHHHHHHHHCSSCGGGCCSTTBE80 (360)
Q ss_pred81EECCCCCCCCCCEEEEEEEECCCCEEEEEECCCCHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHH160 (360)
Q d20180514_481LSSGGLRASGGVMSDLIVMSFTEVFFRWSVNGADRKKDLSWITQHACPFGINIWIRDDLKFHAVQGPNIYAKAATMFNKA160 (360)
T 3A8I_A81LYSGMLNASGGVIDDLIVYYFTEDFFRLVVNSATREKDLSWITQHAEPFGIEITVRDDLSMIAVQGPNAQAKAATLFNDA160 (360)
T ss_pred81EEEEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHCCCCCCEEEECCCEEEEEEECHHHHHHHHHHCCHH160 (360)
T ss_dssp81EEEEEECTTSCEEEEEEEEEEETTEEEEEECSTTHHHHHHHHHHHHGGGTCEEEEETTEEEEEEESTTHHHHHHTTCCHH160 (360)
Q ss_pred161HHHHHHCCCCCCCCCCCCEEEECCCCCCCCCEEECCCCCHHHHHHHHHHHCCCCEEECCCCCHHHHHHCCCCCCCCCCCC240 (360)
Q d20180514_4161QRWAVDGCKPFFGVQAGDLFDATTGYQGEAGSEIDLPNEKAFWFWHALVEAGGKFCGRAARDTLYLLAGANLYGCMWDEP240 (360)
T 3A8I_A161QRQAVEGMKPFFGVQAGDLFIATTGYTGEAGYEIALPNEKAADFWRALVEAGVKPCGLGARDTLRLEAGMNLYGQEMDET240 (360)
T ss_pred161HHHCCCCCCEEEEECCEEEEEEECCCCCCCEEEEEECHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCCCCCCC240 (360)
T ss_dssp161HHHHHTTCCSSBEEEETTEEEECCCSSSSCEEEEEEEHHHHHHHHHHHHHTTCEECCHHHHHHHHHHHTCCCBTTTBCTT240 (360)
Q ss_pred241CCCCCCCC-------------------------------CEEEEC-----------------------------------320 (360)
Q d20180514_4241IGPLAANG-------------------------------GITIPW-----------------------------------320 (360)
T 3A8I_A241ISPLAANMGWTIAWEPADRDFIGREALEVQREHGTEKLVGLVMTEKGVLRNELPVRFTDAQGNQHEGIITSGTFSPTLGY320 (360)
T ss_pred241CCHHHCCCHHHHCCCCCCCCCCCHHHHHHHHHCCCEEEEEEEECCCCCCCCCCEEEECCCCCCEEEEEEECCCCCCCCCC320 (360)
T ss_dssp241SCGGGTTCGGGCCCCSTTCCCTTHHHHHHHHHHCCCEEEEEEECSSSCCCTTCEEEEECTTSCEEEEEEEEEEEETTTTE320 (360)
Q ss_pred321-------CCCC------------CCCCCHHHH-HHHHHCC360 (360)
Q d20180514_4321-------EPAI------------MDFCGREAT-EMGVEHG360 (360)
T 3A8I_A321SIALARVPEGIGETAIVQIRNREMPVKVTKPVFVRNGKAV360 (360)
T ss_pred321EEEEEEECCCCCCEEEEEECCEEEEEEEEECCCCCCCCCC360 (360)
T ss_dssp321EEEEEEECTTCCSEEEEEETTEEEEEEEECSCSEETTEEC360 (360)


No 2
> 3A8K_A        Alignment in PIR format
MAC score = 208.29	Identity = 0.65

Download partial structureDownload full-length structure
Q ss_pred1CCCCCHHHHHCCCEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCEEEEEECCCHHHHHCCCCCCCCCCCCCCCCE80 (360)
Q d20180514_41NWWMYPCHTLWEARRVDHHGWIGPLHYGSQIDEHQATRTDAGTFPVAWRTIVKLRTSRTREFLRYLPANDPAKLTKSGKA80 (360)
T 3A8K_A1QTPLYEQHTLCGARMVDFHGWMMPLHYGSQIDEHHAVRTDAGMFDVSHMTIVDLRGSRTREFLRYLLANDVAKLTKSGKA80 (360)
T ss_pred1CCCCHHHHHHCCCEEEEECCEECCCCCCCHHHHHHHHHHCCEEEECCCCEEEEEECCCHHHHHHHHCCCCHHHCCCCCEE80 (360)
T ss_dssp1ECTTHHHHHHTTCEEEEETTEEEEEESSCHHHHHHHHHHSCEEEECTTSEEEEEESTTHHHHHHHHCSSCGGGCCSTTBE80 (360)
Q ss_pred81EECCCCCCCCCCEEEEEEEECCCCEEEEEECCCCHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHH160 (360)
Q d20180514_481LSSGGLRASGGVMSDLIVMSFTEVFFRWSVNGADRKKDLSWITQHACPFGINIWIRDDLKFHAVQGPNIYAKAATMFNKA160 (360)
T 3A8K_A81LYSGMLNASGGVIDNLIVYYFTEDFFRLVVNSATREKDLSWITQHAEPFGIEITVRDDLSMIAVQGPNAQAKAATLFNDA160 (360)
T ss_pred81EEEEEECCCCCEEEEEEEEEEECCEEEEEECCCCHHHHHHHHHHHCCCCCCEEEEECCEEEEEEECHHHHHHHHHHCCCH160 (360)
T ss_dssp81EEEEEECTTSCEEEEEEEEEEETTEEEEEECSTTHHHHHHHHHHHHGGGTCEEEEETTEEEEEEESTTHHHHHHTTSCHH160 (360)
Q ss_pred161HHHHHHCCCCCCCCCCCCEEEECCCCCCCCCEEECCCCCHHHHHHHHHHHCCCCEEECCCCCHHHHHHCCCCCCCCCCCC240 (360)
Q d20180514_4161QRWAVDGCKPFFGVQAGDLFDATTGYQGEAGSEIDLPNEKAFWFWHALVEAGGKFCGRAARDTLYLLAGANLYGCMWDEP240 (360)
T 3A8K_A161QRQAVEGMKPFFGVQAGDLFIATTGYTGEAGYEIALPNEKAADFWRALVEAGVKPCGLGARDTLRLEAGMNLYGQEMDET240 (360)
T ss_pred161HHHCCCCCCEEEEECCEEEEEEECCCCCCCEEEEEECHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCCCCCCC240 (360)
T ss_dssp161HHHHHTTCCSSBEEEETTEEEECCCSSSSCEEEEEEEHHHHHHHHHHHHHTTCEECCHHHHHHHHHHTTCCCBTTTBCTT240 (360)
Q ss_pred241CCCCCCCC-----------------------------CEEEEC-------------------------------------320 (360)
Q d20180514_4241IGPLAANG-----------------------------GITIPW-------------------------------------320 (360)
T 3A8K_A241ISPLAANMGWTIAWEPADRDFIGREALEVQREHGTEKLVGLVMTEKGVLRNELPVRFTDAQGNQHEGIITSGTFSPTLGY320 (360)
T ss_pred241CCHHHCCCHHHHCCCCCCCCCCCHHHHHHHHCCCCEEEEEEEECCCCCCCCCCEEEECCCCCCEEEEEEECCCCCCCCCC320 (360)
T ss_dssp241SCGGGTTCGGGCCCCSTTCCCTTHHHHHHHHHHCCCEEEEEEECSSSCCCTTCEEEEECTTSCEEEEEEEEEEEETTTTE320 (360)
Q ss_pred321-------CCCC------------CCCCCHHH-HHHHHHCC360 (360)
Q d20180514_4321-------EPAI------------MDFCGREA-TEMGVEHG360 (360)
T 3A8K_A321SIALARVPEGIGETAIVQIRNREMPVKVTKPVFVRNGKAV360 (360)
T ss_pred321EEEEEEECCCCCCEEEEEECCEEEEEEEEECCCCCCCCCC360 (360)
T ss_dssp321EEEEEEECTTCCSEEEEECSSSEEEEEEECSCCEETTEEC360 (360)


No 3
> 1VLO_A    Aminomethyltransferase; NP417381, tetrahydrofolat dependent) of glycine cleavage system, structural genomics, protein structure initiative; HET: MSE; 1.70A {Escherichia coli K12} SCOP: b.44.2.1 d.250.1.1 PDB: 3a8j_A* 3a8i_A* 3a8k_A*     Alignment in PIR format
MAC score = 207.85	Identity = 0.67

Download partial structureDownload full-length structure
Q ss_pred1CCCCCHHHHHCCCEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCEEEEEECCCHHHHHCCCCCCCCCCCCCCCCE80 (357)
Q d20180514_41NWWMYPCHTLWEARRVDHHGWIGPLHYGSQIDEHQATRTDAGTFPVAWRTIVKLRTSRTREFLRYLPANDPAKLTKSGKA80 (357)
T 1VLO_A1QTPLYEQHTLCGARMVDFHGWMMPLHYGSQIDEHHAVRTDAGMFDVSHMTIVDLRGSRTREFLRYLLANDVAKLTKSGKA80 (357)
T ss_pred1CCCHHHHHHHCCCEEEEECCEECCEECCCHHHHHHHHHCCEEEEECCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCE80 (357)
T ss_dssp1CCTTHHHHHHTTCEEEEETTEEEEEESSCHHHHHHHHHHSCEEEECTTSEEEEEESTTHHHHHHHHBSSCGGGCCSTTBE80 (357)
Q ss_pred81EECCCCCCCCCCEEEEEEEECCCCEEEEEECCCCHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHH160 (357)
Q d20180514_481LSSGGLRASGGVMSDLIVMSFTEVFFRWSVNGADRKKDLSWITQHACPFGINIWIRDDLKFHAVQGPNIYAKAATMFNKA160 (357)
T 1VLO_A81LYSGMLNASGGVIDDLIVYYFTEDFFRLVVNSATREKDLSWITQHAEPFGIEITVRDDLSMIAVQGPNAQAKAATLFNDA160 (357)
T ss_pred81EEEEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHCCCCCEEEEECCCEEEEEEECCCCHHHHHHHHHHC160 (357)
T ss_dssp81EEEEEECTTSCEEEEEEEEEEETTEEEEEECGGGHHHHHHHHHHHHGGGTCEEEECTTEEEEEEESTTHHHHHHTTCCHH160 (357)
Q ss_pred161HHHHHHCCCCCCCCCCCCEEEECCCCCCCCCEEECCCCCHHHHHHHHHHHCCCCEEECCCCCHHHHHHCCCCCCCCCCCC240 (357)
Q d20180514_4161QRWAVDGCKPFFGVQAGDLFDATTGYQGEAGSEIDLPNEKAFWFWHALVEAGGKFCGRAARDTLYLLAGANLYGCMWDEP240 (357)
T 1VLO_A161QRQAVEGMKPFFGVQAGDLFIATTGYTGEAGYEIALPNEKAADFWRALVEAGVKPCGLGARDTLRLEAGMNLYGQEMDET240 (357)
T ss_pred161CCCCHHHCCCCEEEEECCEEEEECCCCCCCEEEEEECHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCCCCCCCCCC240 (357)
T ss_dssp161HHHHHTTCCSSBEEEETTEEEECCCSSSSCEEEEEEEHHHHHHHHHHHHHTTCEECCHHHHHHHHHHTTCCCBTTTBCTT240 (357)
Q ss_pred241CCCCCCCCC-----------------------------EEEEC-------------------------------------320 (357)
Q d20180514_4241IGPLAANGG-----------------------------ITIPW-------------------------------------320 (357)
T 1VLO_A241ISPLAANMGWTIAWEPADRDFIGREALEVQREHGTEKLVGLVMTEKGVLRNELPVRFTDAQGNQHEGIITSGTFSPTLGY320 (357)
T ss_pred241CCHHHCCCCCEECCCCCCCCCCCHHHHHHHHHCCCCEEEEEEECCCCCCCCCCEEEECCCCCCEEEEEEEEEEECCCCCC320 (357)
T ss_dssp241SCGGGTTCGGGCCCCSTTCCCTTHHHHHHHHHHCCCEEEEEEECSSSCCCTTCEEEEECTTCCEEEEEEEEEEEETTTTE320 (357)
Q ss_pred321-------CCCCC-CC--CC------HHHHHH-HHHCC357 (357)
Q d20180514_4321-------EPAIM-DF--CG------REATEM-GVEHG357 (357)
T 1VLO_A321SIALARVPEGIGETAIVQIRNREMPVKVTKPVFVRNG357 (357)
T ss_pred321EEEEEEEECCCCCEEEEEECCEEEEEEEEECCCCCCC357 (357)
T ss_dssp321EEEEEEECTTCCSEEEEEETTEEEEEEEECSCCEETT357 (357)


No 4
> 1WOS_A    Aminomethyltransferase; T-protein; 1.84A {Thermotoga maritima} SCOP: b.44.2.1 d.250.1.1 PDB: 1woo_A* 1wop_A* 1wor_A     Alignment in PIR format
MAC score = 187.42	Identity = 0.25

Download partial structureDownload full-length structure
Q ss_pred1CCCCCHHHHHCCCEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCEEEEEECCCHHHHHCCCCCCCCCCCCCCCCE80 (358)
Q d20180514_41NWWMYPCHTLWEARRVDHHGWIGPLHYGSQIDEHQATRTDAGTFPVAWRTIVKLRTSRTREFLRYLPANDPAKLTKSGKA80 (358)
T 1WOS_A1RTPLFEKHVELGAKMVDFAGWEMPLYYTSIFEEVMAVRKSVGMFDVSHMGEFLVKGPEAVSFIDFLITNDFSSL-PDGKA80 (358)
T ss_pred1CCCCHHHHHHCCCEEEEECCEECCEECCCHHHHHHHHHHCEEEEECCCCEEEEEECCCHHHHHHHHCCCCCCCC-CCCCE80 (358)
T ss_dssp1CCTTHHHHHHTTCEEEEETTEEEEEESSCHHHHHHHHHHSCEEEECTTSEEEEEESTTHHHHHHHHBSSCCTTC-CTTEE80 (358)
Q ss_pred81EECCCCCCCCCCEEEEEEEECCCCEEEEEECCCCHHHHHHHHHHHCCCCCCEEEEEC-CCCCCCCCCCCHHHHHHHHHHH160 (358)
Q d20180514_481LSSGGLRASGGVMSDLIVMSFTEVFFRWSVNGADRKKDLSWITQHACPFGINIWIRD-DLKFHAVQGPNIYAKAATMFNK160 (358)
T 1WOS_A81IYSVMCNENGGIIDDLVVYKVSPDEALMVVNAANIEKDFNWIKSHSKNFDVEVSNISDTTALIAFQGPKAQETLQELVED160 (358)
T ss_pred81EEEEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHCCCCCCEEEEECCCEEEEEEECCCHHHHHHHHHCC160 (358)
T ss_dssp81EEEEEECTTSCEEEEEEEEEEETTEEEEEECGGGHHHHHHHHHTTCTTSSCEEEECGGGEEEEEEESTTHHHHHGGGBSS160 (358)
Q ss_pred161HHHHHHHCCCCCCCCCCCCEEEECCCCCCCCCEEECCCCCHHHHHHHHH----HHCCCCEEECCCCCHHHHHHCCCCCCC240 (358)
Q d20180514_4161AQRWAVDGCKPFFGVQAGDLFDATTGYQGEAGSEIDLPNEKAFWFWHAL----VEAGGKFCGRAARDTLYLLAGANLYGC240 (358)
T 1WOS_A161GLEEIAYYSFRKSIVAGVETLVSRTGYTGEDGFELMLEAKNAPKVWDALMNLLRKIDGRPAGLGARDVCRLEATYLLYGQ240 (358)
T ss_pred161CHHHCCCCEEEEEEECCCEEEEEECCCCCCCEEEEEECHHHHHHHHHHHHHCCCCCCCEECCHHHHHHHHHHCCCCCCCC240 (358)
T ss_dssp161CSTTSCTTBEEEEEETTEEEEEESCCSSSSSEEEEEEEGGGHHHHHHHHHHHHHHHTCEECCHHHHHHHHHHTTCCCBTT240 (358)
Q ss_pred241CCCCCCCCCCCCC--------------------------CEEEECC----------------------------------320 (358)
Q d20180514_4241MWDEPIGPLAANG--------------------------GITIPWE----------------------------------320 (358)
T 1WOS_A241DMDENTNPFEVGLSWVVKLNKDFVGKEALLKAKEKVERKLVALELSGKRIARKGYEVLKNGERVGEITSGNFSPTLGKSI320 (358)
T ss_pred241CCCCCCCHHHCCCCCCCCCCCCCCCHHHHHHHHCCCCEEEEEEEECCCCCCCCCCEEEECCCEEEEEECCCCCCCCCCEE320 (358)
T ss_dssp241TBCTTSCGGGGTCGGGCCTTSCCTTHHHHHHHHHTCCEEEEEEEESSSCCCCTTCEEEETTEEEEEEEEEEEETTTTEEE320 (358)
Q ss_pred321------CCCC---CC--CC-------HHHHHHH-HHCC358 (358)
Q d20180514_4321------PAIM---DF--CG-------REATEMG-VEHG358 (358)
T 1WOS_A321ALALVSKSVKIGDQLGVVFPGGKLVEALVVKKPFYRGS358 (358)
T ss_pred321EEEEECCCCCCCCEEEEEECCCCEEEEEEEECCCCCCC358 (358)
T ss_dssp321EEEEEETTCCTTCEEEEEETTTEEEEEEEECSCSCCCS358 (358)


No 5
> 1YX2_A    Aminomethyltransferase; glycine cleavage system T protein, alpha-beta, beta-barrel, structural genomics, PSI, protein structure initiative; 2.08A {Bacillus subtilis}     Alignment in PIR format
MAC score = 187.09	Identity = 0.26

Download partial structureDownload full-length structure
Q ss_pred1CCCCCHHHHHCCCEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCEEEEEECCCHHHHHCCCCCCCCCCCCCCCCE80 (357)
Q d20180514_41NWWMYPCHTLWEARRVDHHGWIGPLHYGSQIDEHQATRTDAGTFPVAWRTIVKLRTSRTREFLRYLPANDPAKLTKSGKA80 (357)
T 1YX2_A1RTPLFDLYKEYGGKTIDFGGWELPVQFSSIKKEHEAVRTAAGLFDVSHMGEVEVSGNDSLSFLQRLMTNDVSALT-PGRA80 (357)
T ss_pred1CCCCHHHHHHCCCEEEEECCEECCCCCCCHHHHHHHHHHCEEEEECCCCEEEEEECCCHHHHHHHHCCCCCCCCC-CCCE80 (357)
T ss_dssp1CCTTGGGHHHHTCEEEEETTEEEEEESSCHHHHHHHHHHSEEEEECTTSEEEEEESTTHHHHHHHHBSSCGGGCC-TTBE80 (357)
Q ss_pred81EECCCCCCCCCCEEEEEEEECCCCEEEEEECCCCHHHHHHHHHHHCCCCCCEEEEE-CCCCCCCCCCCCHHHHHHHHHHH160 (357)
Q d20180514_481LSSGGLRASGGVMSDLIVMSFTEVFFRWSVNGADRKKDLSWITQHACPFGINIWIR-DDLKFHAVQGPNIYAKAATMFNK160 (357)
T 1YX2_A81QYTAMCYPDGGTVDDLLIYQKGENRYLLVINASNIDKDLAWMKEHAAG-DVQIDNQSDQIALLAVQGPKAEAILKNLTDA160 (357)
T ss_pred81EEEEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHCCC-CEEEEECCCCEEEEEEECCCHHHHHHHHHCC160 (357)
T ss_dssp81EEEEEECTTSCEEEEEEEEEEETTEEEEEECGGGHHHHHHHHHHTCCS-SCEEEECTTTEEEEEEESTTHHHHHHTTBSS160 (357)
Q ss_pred161HHHHH-HHCCCCCCCCCCCCEEEECCCCCCCCCEEECCCCCHHHHHHHHH----HHCCCCEEECCCCCHHHHHHCCCCCC240 (357)
Q d20180514_4161AQRWA-VDGCKPFFGVQAGDLFDATTGYQGEAGSEIDLPNEKAFWFWHAL----VEAGGKFCGRAARDTLYLLAGANLYG240 (357)
T 1YX2_A161DVSALKPFAFIDEADISGRKALISRTGYTGEDGYEIYCRSDDAMHIWKKIIDAGDAYGLIPCGLGARDTLRFEANIPLYG240 (357)
T ss_pred161CCCCCCCCEEEEEEEECCCEEEEEECCCCCCCEEEEEECHHHHHHHHHHHHHCCHHCCCEECCHHHHHHHHHHCCCCCCC240 (357)
T ss_dssp161CGGGCCTTBEEEEEEETTEEEEEESCCSSSSSEEEEEEEGGGHHHHHHHHHHHHGGGTEEEECHHHHHHHHHHTTCCCBT240 (357)
Q ss_pred241CCCCCCCCCCCCC-----------------------------CCEEEECCCCC---------------------------320 (357)
Q d20180514_4241CMWDEPIGPLAAN-----------------------------GGITIPWEPAI---------------------------320 (357)
T 1YX2_A241QELTRDITPIEAGIGFAVKHKKESDFFGKSVLSEQKENGAKRKLVGLEMIEKGIPRHGYEVFQNGKSVGKVTTGTQSPTL320 (357)
T ss_pred241CCCCCCCCHHHCCCCCEECCCCCCCCCCHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCEEEECCCEEEEEECCCCCCCC320 (357)
T ss_dssp241TTBSTTCCTTTTTCGGGCCTTCSSCCTTHHHHHHHHHHCCSEEEEEEEESSSCCCCTTCEEEETTEEEEEEEEEEEETTT320 (357)
Q ss_pred321-C----CCCCHHH-------HHHH---------HHCC357 (357)
Q d20180514_4321-M----DFCGREA-------TEMG---------VEHG357 (357)
T 1YX2_A321GKNVGLALIDSETSEIGTVVDVEIRKKLVKAKVVKTP357 (357)
T ss_pred321CCEEEEEEECHHHCCCCCEEEEEECCEEEEEEEEECC357 (357)
T ss_dssp321TEEEEEEEEEGGGCSTTCEEEEEETTEEEEEEEECCC357 (357)


No 6
> 1WSV_A        Alignment in PIR format
MAC score = 173.74	Identity = 0.25

Download partial structureDownload full-length structure
Q ss_pred1CCCCCHHHHHCCCEEECCCCCCCCCCCC-CHHHHHHHHHHCCCCCCCCCCEEEEEECCCHHHHHCCCCCCCCCCCCCCCC80 (366)
Q d20180514_41NWWMYPCHTLWEARRVDHHGWIGPLHYG-SQIDEHQATRTDAGTFPVAWRTIVKLRTSRTREFLRYLPANDPAKLTKSGK80 (366)
T 1WSV_A1RTPLYDFHLAHGGKMVAFAGWSLPVQYRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAEL-RPNQ80 (366)
T ss_pred1CCCCHHHHHHCCCEEEEECCEECCCCCCCHHHHHHHHHHHCCEEEECCCCEEEEEECCCHHHHHHHHCCCCCCCC-CCCE80 (366)
T ss_dssp1CCTTHHHHHHTTCCEEEETTEEEESCCSSCHHHHHHHHHHSEEEEECTTSEEEEEESTTHHHHHHTTBSSCCTTC-CTTE80 (366)
Q ss_pred81EEECCCCCCCCCCEEEEEEEECCCCEEEEEECCCCHHHHHHHHHHHCCC---CCCEEEEEC-CCCCCCCCCCCHHHHHHH160 (366)
Q d20180514_481ALSSGGLRASGGVMSDLIVMSFTEVFFRWSVNGADRKKDLSWITQHACP---FGINIWIRD-DLKFHAVQGPNIYAKAAT160 (366)
T 1WSV_A81GTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQA160 (366)
T ss_pred81EEEEEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCEEEEEEECHHHHHHHHH160 (366)
T ss_dssp81EEEEEEECTTCCEEEEEEEEECTTSSEEEEECGGGHHHHHHHHHHHHHHHHTTTCCCEEEECCCEEEEEESTTHHHHHHT160 (366)
Q ss_pred161HHHHHHHH-HHHCCCCCCCCCCCCEEEECCCCCCCCCEEECCCCCHHHHHHHHHHHCC-CCEEECCCCCHHHHHHCCCCC240 (366)
Q d20180514_4161MFNKAQRW-AVDGCKPFFGVQAGDLFDATTGYQGEAGSEIDLPNEKAFWFWHALVEAG-GKFCGRAARDTLYLLAGANLY240 (366)
T 1WSV_A161GVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLY240 (366)
T ss_pred161HCCCCHHHCCCCEEEEEEECCCCCEEEECCCCCCCCEEEEEECHHHHHHHHHHHHHCCCCEEECHHHHHHHHHHHHHHHC240 (366)
T ss_dssp161TCSSCGGGSCTTBEEEEEETTEEEEEEESCCSSSSSEEEEEECHHHHHHHHHHHHTSTTEEECCHHHHHHHHHHTTCCCB240 (366)
Q ss_pred241CCCCCCCCCCCCCC-----------------------------------------------------------CCEEEEC320 (366)
Q d20180514_4241GCMWDEPIGPLAAN-----------------------------------------------------------GGITIPW320 (366)
T 1WSV_A241GNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPS320 (366)
T ss_pred241CCCCCCCCCHHHCCCHHHCCCCCCCCCCCCCHHHHHHHHHCCCCEEEEEEEEECCCCCCCCCEECCCCEEEEEEEECEEC320 (366)
T ss_dssp241TTTBCTTCCTTTTTCGGGSCHHHHHHTCSTTHHHHHHHHTTCCSEEEEEEEESSSCCCTTCEEECTTSCEEEEEEEEEEE320 (366)
Q ss_pred321------------C-----CCCCCCC-C------HHHH-HHHHH-CC366 (366)
Q d20180514_4321------------E-----PAIMDFC-G------REAT-EMGVE-HG366 (366)
T 1WSV_A321PSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNY366 (366)
T ss_pred321CCCCCEEEEEEECCHHCCCCCEEEEEECCEEEEEEEEECCCCCCCC366 (366)
T ss_dssp321TTTTEEEEEEEEEGGGCSTTCEEEEECSSSEEEEEEECSCSSCCCC366 (366)


No 7
> 3GIR_A    Aminomethyltransferase; glycine cleavage system, aminotransferase, structural genomics; 1.60A {Bartonella henselae}     Alignment in PIR format
MAC score = 170.71	Identity = 0.27

Download partial structureDownload full-length structure
Q ss_pred1CCCCCHHHHHCCCEEECCCCCCCCCCCC-CHHHHHHHHHHCCCCCCCCCCEEEEEECCCHHHHHCCCCCCCCCCCCCCCC80 (362)
Q d20180514_41NWWMYPCHTLWEARRVDHHGWIGPLHYG-SQIDEHQATRTDAGTFPVAWRTIVKLRTSRTREFLRYLPANDPAKLTKSGK80 (362)
T 3GIR_A1TLPLYELHEKAGAKFGAFAGWRMPLTYPLGVLKEHLHTRAHAGLFDISHMKLIAVEGPKAVEFLSYALPVDAALL-KIGQ80 (362)
T ss_pred1CCCCHHHHHHCCCEEEEECCEEECCCCCCCHHHHHHHHHCCCEEEECCCCEEEEEECCCHHHHHHHHCCCCCCCC-CCCC80 (362)
T ss_dssp1ECTTHHHHHHTTCEEEEETTEEEEEECTTCHHHHHHHHHHSEEEEECTTSEEEEEESTTHHHHHHHHSSSCTTTS-CTTB80 (362)
Q ss_pred81EEECCCCCCCCCCEEEEEEEECCCCEEEEEECCCCHHHHHHHHHHHCCCCCCEEEEEC-CCCCCCCCCCCHHHHHHHHHH160 (362)
Q d20180514_481ALSSGGLRASGGVMSDLIVMSFTEVFFRWSVNGADRKKDLSWITQHACPFGINIWIRD-DLKFHAVQGPNIYAKAATMFN160 (362)
T 3GIR_A81SRYSYLLNERAGILDDLILTRLAECRFMLVANAGNAQADFAELEKRAFGFE--CQVIALERVLLALQGPQAAAVLADAGL160 (362)
T ss_pred81EEEEEEECCCCCEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHCCCCC--EEEEECCCEEEEEECCCHHHHHHHHCC160 (362)
T ss_dssp81EEEEEEECTTCCEEEEEEEEEEETTEEEEEECGGGHHHHHHHHHHHTTTSS--CEEEECCCEEEEEESTTHHHHHHHTTC160 (362)
Q ss_pred161HHHHHHHHCCCCCCCCCCCCEEEECCCCCCCCCEEECCCCCHHHHHHHHHHHCC-CCEEECCCCCHHHHHHCCCCCCCCC240 (362)
Q d20180514_4161KAQRWAVDGCKPFFGVQAGDLFDATTGYQGEAGSEIDLPNEKAFWFWHALVEAG-GKFCGRAARDTLYLLAGANLYGCMW240 (362)
T 3GIR_A161PGNE--LLFM-QGF-EPQQDWFITRSGYTGEDGFEIALPIGCARALAEKLLGDSRVEWVGLAARDSLRLEAGLCLHGNDI240 (362)
T ss_pred161CHHH--CCCC-EEE-ECCCEEEEEECCCCCCCEEEEEEEHHHHHHHHHHHHHCCCCEECCHHHHHHHHHHCCCCCCCCCC240 (362)
T ss_dssp161CCTT--CCTT-BEE-CSSTTCEEESCCSSSSSEEEEEECHHHHHHHHHHHHTSTTEEECCHHHHHHHHHHTTCCCBTTTB240 (362)
Q ss_pred241CCCCCCCCCC-------------------------------CCEEEECCC------------------------------320 (362)
Q d20180514_4241DEPIGPLAAN-------------------------------GGITIPWEP------------------------------320 (362)
T 3GIR_A241TPDTTPIDAALTWAVPKNVREKAQFYGAKAFLESLQKGPSRCRVGLKPQTRQPIRAGAVLFDNEGNRIGVVTSGGFGPSF320 (362)
T ss_pred241CCCCCHHHCCCCCEECCCCCCCCCCCCHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCEEECCCCEEECEEECCCCCCCC320 (362)
T ss_dssp241CTTCCTTTTTCGGGSCHHHHHHCCSTTHHHHHHHHHHCCSSEEEEEEESSSSCCCTTCEEECTTSCEEEEEEEEEEETTT320 (362)
Q ss_pred321-----------CC----C---------CCCCHHHHHHHHHCC362 (362)
Q d20180514_4321-----------AI----M---------DFCGREATEMGVEHG362 (362)
T 3GIR_A321DGPVAMGYVPVAWKVEGTEVFTELRGKKIALSVHSLPFVEQR362 (362)
T ss_pred321CCEEEEEEECHHHCCCCCEEEEEECCEEEEEEEEECCCCCCC362 (362)
T ss_dssp321TEEEEEEEECGGGCSTTCEEEEEETTEEEEEEEECSCSSCCC362 (362)


No 8
> 1V5V_A    Aminomethyltransferase; glycine-cleavage sytem, structural riken structural genomics/proteomics initiative, RSGI; 1.50A {Pyrococcus horikoshii} SCOP: b.44.2.1 d.250.1.1     Alignment in PIR format
MAC score = 170.47	Identity = 0.23

Download partial structureDownload full-length structure
Q ss_pred1CCCCCHHHHHCCCEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCEEEEEECCCHHHHHCCCCCCCCCCCCCCCCE80 (390)
Q d20180514_41NWWMYPCHTLWEARRVDHHGWIGPLHYGSQIDEHQATRTDAGTFPVAWRTIVKLRTSRTREFLRYLPANDPAKLTKSGKA80 (390)
T 1V5V_A1RVHIFDWHKEHARKIEEFAGWEMPIWYSSIKEEHLAVRNAVGIFDVSHMGEIVFRGKDALKFLQYVTTNDISKPP-AISG80 (390)
T ss_pred1CCCCHHHHHHCCCEEEEECCEECCEECCCHHHHHHHHHHCEEEEECCCCEEEEEECCCHHHHHHHHCCCCCCCCC-CCCE80 (390)
T ss_dssp1CCTTHHHHHHHCSEEEEETTEEEEEESSCHHHHHHHHHHSCEEEECTTSEEEEEESTTHHHHHHHHSSSCTTSSC-SSEE80 (390)
Q ss_pred81EECCCCCCCCCCEEEEEEEECCCCEEEEEECCCCHHHHHHHHHHHCCC------CCCEEEEEC-CCCCCCCCCCCHHHHH160 (390)
Q d20180514_481LSSGGLRASGGVMSDLIVMSFTEVFFRWSVNGADRKKDLSWITQHACP------FGINIWIRD-DLKFHAVQGPNIYAKA160 (390)
T 1V5V_A81TYTLVLNERGAIKDETLVFNMGNNEYLMICDSDAFEKLYAWFTYLKRTIEQFTKLDLEIELKTYDIAMFAVQGPKARDLA160 (390)
T ss_pred81EEEEEECCCCCEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCEEEEEEECCCHHHHH160 (390)
T ss_dssp81EEEEEECTTSCEEEEEEEEEEETTEEEEEECTTTHHHHHHHHHHHHHHHHTTSCCCCEEEECTTTEEEEEEESTTHHHHH160 (390)
Q ss_pred161HHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCCCCCCEEECCCC--------------CHHHHHHHHHH----HCCCCE240 (390)
Q d20180514_4161ATMFNKAQRWAVDGCKPFFGVQAGDLFDATTGYQGEAGSEIDLPN--------------EKAFWFWHALV----EAGGKF240 (390)
T 1V5V_A161KDLFGIDINEMWWFQARWVELDGIKMLLSRSGYTGENGFEVYIEDANPYHPDESKRGEPEKALHVWERILEEGKKYGIKP240 (390)
T ss_pred161HHHHCCCCCCCCCCEEEEEEECCEEEEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEE240 (390)
T ss_dssp161HHHHSCCGGGSCTTBEEEEEETTEEEEEECCCSSSSCEEEEEEECCCTTCSSGGGCCCCHHHHHHHHHHHHHHGGGTCEE240 (390)
Q ss_pred241EECCCCCHHHHHHCCCCCCCCCCC--------------------------CCCCCCC----------CCCEEEECC----320 (390)
Q d20180514_4241CGRAARDTLYLLAGANLYGCMWDE--------------------------PIGPLAA----------NGGITIPWE----320 (390)
T 1V5V_A241CGLGARDTLRLEAGYTLYGNETKELQLLSTDIDEVTPLQANLEFAIYWDKDFIGKDALLKQKERGVGRKLVHFKMIDKGI320 (390)
T ss_pred241CCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCCCCCCHHHHHHHHHCCCCEEEEEEEECCCCC320 (390)
T ss_dssp241ECHHHHHHHHHHHTCCCBTTTBCCCCCSSCSCCSSCTTTTTCGGGCCTTSCCTTHHHHHHHHHHCCCEEEEEEEESSSCC320 (390)
Q ss_pred321------------------------------------CCC---------------CCCCCHHHHHHHHHCC390 (390)
Q d20180514_4321------------------------------------PAI---------------MDFCGREATEMGVEHG390 (390)
T 1V5V_A321PREGYKVYANGEMIGEVTSGTLSPLLNVGIGIAFVKEEYAKPGIEIEVEIRGQRKKAVTVTP-PFYDPKK390 (390)
T ss_pred321CCCCCEEEECCCCEEEEECCCCCCCCCCEEEEEEECHHHCCCCCEEEEEECCEEEEEEEEEC-CCCCCCC390 (390)
T ss_dssp321CCTTCEEEETTEEEEEEEEEEECTTTCSEEEEEEEEGGGCSTTCEEEEEETTEEEEEEEECS-CSSCTTT390 (390)


No 9
> 2GAH_A        Alignment in PIR format
MAC score = 169.77	Identity = 0.18

Download partial structureDownload full-length structure
Q ss_pred1CCCCCHHHHHCCCEEECCCCCCCCCCCC--------CHHHHHHHHHHCCCCCCCCCCEEEEEECCCHHHHHCCCCCCCCC80 (387)
Q d20180514_41NWWMYPCHTLWEARRVDHHGWIGPLHYG--------SQIDEHQATRTDAGTFPVAWRTIVKLRTSRTREFLRYLPANDPA80 (387)
T 2GAH_A1ITAMHSWHLSHGAEFEDVGQWKRPWYYPQAGETMDQAVYRESKAVRDSVGMLDATTLGKIEIRGKDAAEFLNRIYTNGYT80 (387)
T ss_pred1CCCCHHHHHHCCCEEEEECCEECCCCCCCCCCCHHHHHHHHHHHHHHCCEEEECCCCEEEEEECCCHHHHHHHHCCCCCC80 (387)
T ss_dssp1CCTTHHHHHHTTCEEEEETTEEEEEECCCTTCCHHHHHHHHHHHHHHSCEEEECTTSEEEEEESTTHHHHHHHHBSSCCT80 (387)
Q ss_pred81CCCCCCCEEECCCCCCCCCCEEEEEEEECCCCEEEEEECCCCHHHHHHHHHHHCCC----CCCEEEEE-CCCCCCCCCCC160 (387)
Q d20180514_481KLTKSGKALSSGGLRASGGVMSDLIVMSFTEVFFRWSVNGADRKKDLSWITQHACP----FGINIWIR-DDLKFHAVQGP160 (387)
T 2GAH_A81KL-KVGMGRYGVMCKADGMIFDDGVTLRLAEDRFLLHTTTGGAADVLDWLEEWLQTEWPDLDVTCTSVTEQLATVAVVGP160 (387)
T ss_pred81CC-CCCEEEEEEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCEEEEEECCH160 (387)
T ss_dssp81TC-CTTBEEEEEEECTTCCEEEEEEEEEEETTEEEEEECTTTHHHHHHHHHHHHHHTCTTSCCEEEECTTTEEEEEEEST160 (387)
Q ss_pred161CHHHHHHHHHHHHH--H-HHHHCCCCCCCC-CCCCEEEECCCCCCCCCEEECCCCCHHHHHHHHHHH----CCCCEEECC240 (387)
Q d20180514_4161NIYAKAATMFNKAQ--R-WAVDGCKPFFGV-QAGDLFDATTGYQGEAGSEIDLPNEKAFWFWHALVE----AGGKFCGRA240 (387)
T 2GAH_A161RSRDVIAKLASTVDVSNEGFKFMAFKDVVLDSGIEARISRISFSGELAFEIAVPAWHGLRVWEDVYAAGEEFNITPYGTE240 (387)
T ss_pred161HHHHHHHHHCCCCCCCHHHCCCCEEEEEEEECCCEEEEEEECCCCCCEEEEEECHHHHHHHHHHHHHCCHHCCCEEEEHH240 (387)
T ss_dssp161THHHHHHHHCTTSCCSTTTSCTTBEEEEECTTSCEEEEECCCSSSSCEEEEEEEGGGHHHHHHHHHHHTGGGTCEECCHH240 (387)
Q ss_pred241CCCHHHHHHCCCCCCCCCCCCCCCCCC----------------------------CCCEEEEC-----------------320 (387)
Q d20180514_4241ARDTLYLLAGANLYGCMWDEPIGPLAA----------------------------NGGITIPW-----------------320 (387)
T 2GAH_A241TMHVLRAEKGFIIVGQDTDGTVTPQDAGMEWVVSKLKDFIGNRSYSRADNAREDRKQLVSVLPVDKSLRLPEGAALVASD320 (387)
T ss_pred241HHHHHHHHHHHHHCCCCCCCCCCHHHCCCHHHHCCCCCCCCHHHHHHHHHCCCCCEEEEEEEEECCCCCCCCCCEEECCC320 (387)
T ss_dssp241HHHHHHHHTTCCCTTTTCCSSCCTTTTTCGGGSCSSSCCTTGGGGGSGGGGCSCCEEEEEEEESSTTCCCCTTCEEEETT320 (387)
Q ss_pred321--------------------------------CC--C-------------CCCCCCHHHHHHHHHCC387 (387)
Q d20180514_4321--------------------------------EP--A-------------IMDFCGREATEMGVEHG387 (387)
T 2GAH_A321ALASEGITPMEGWVTSSYDSPNLGRTFGLALIKNGRNRIGEVLKTPVGDQLVDVVVSET-VLYDPEG387 (387)
T ss_pred321CCCCCCCCCEEEEEECCCCCCCCCCEEEEEEECHHHCCCCCEEEEEECCEEEEEEEECC-CCCCCCC387 (387)
T ss_dssp321CCCBTTBCCCCEEEEEEEEETTTTEEEEEEEEETGGGCTTCEEEEEETTEEEEEEEECS-CCSSTTC387 (387)


No 10
> 1VRQ_A        Alignment in PIR format
MAC score = 167.64	Identity = 0.19

Download partial structureDownload full-length structure
Q ss_pred1CCCCCHHHHHCCCEEECCCCCCCCCCCC--------CHHHHHHHHHHCCCCCCCCCCEEEEEECCCHHHHHCCCCCCCCC80 (388)
Q d20180514_41NWWMYPCHTLWEARRVDHHGWIGPLHYG--------SQIDEHQATRTDAGTFPVAWRTIVKLRTSRTREFLRYLPANDPA80 (388)
T 1VRQ_A1LTAMHPWHLAHGAKFEDVGQWKRPWYYPQDGESMDEAVYRECKAVRDSVGMLDASTLGKIEIRGKDAAEFLNRMYTNGYT80 (388)
T ss_pred1CCCHHHHHHHCCCEEEEECCEECCCCCCCCCCCHHHHHHHHHHHHHHCCEEEECCCCEEEEEECCCHHHHHHHHCCCCCC80 (388)
T ss_dssp1CCTTHHHHHHTTCEEEEETTEEEEEECCCTTCCHHHHHHHHHHHHHHSCEEEECTTSEEEEEESTTHHHHHHHHBSSCCT80 (388)
Q ss_pred81CCCCCCCEEECCCCCCCCCCEEEEEEEECCCCEEEEEECCCCHHHHHHHHHHHCCC----CCCEEEEE-CCCCCCCCCCC160 (388)
Q d20180514_481KLTKSGKALSSGGLRASGGVMSDLIVMSFTEVFFRWSVNGADRKKDLSWITQHACP----FGINIWIR-DDLKFHAVQGP160 (388)
T 1VRQ_A81KL-KVGMGRYGVMCKADGMIFDDGVTLRLAEDRFLMHTTTGGAADVLDWLEEWLQTEWPELDVTCTSVTEQLATVAVVGP160 (388)
T ss_pred81CC-CCCEEEEEEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCEEEEEECCH160 (388)
T ss_dssp81TC-CTTBEEEEEEECTTSCEEEEEEEEEEETTEEEEEECTTTHHHHHHHHHHHHHHTCTTSCCEEEECTTTEEEEEEEST160 (388)
Q ss_pred161CHHHHHHHHHHHHHHHHHHCC--CCCCCC---CCCCEEEECCCCCCCCCEEECCCCCHHHHHHHHHHHC----CCCEEEC240 (388)
Q d20180514_4161NIYAKAATMFNKAQRWAVDGC--KPFFGV---QAGDLFDATTGYQGEAGSEIDLPNEKAFWFWHALVEA----GGKFCGR240 (388)
T 1VRQ_A161RSRDVIAKLASSLD-VSNDAFKFMAFQDVTLDSGIEARISRISFSGELAFEIAIPAWHGLQVWEDVYAAGQEFNITPYGT240 (388)
T ss_pred161HHHHHHHHHCCCCC-CCHHHCCCCEEEEEEEECCCEEEEEEECCCCCCEEEEEECHHHHHHHHHHHHHCCHHCCCEEEEH240 (388)
T ss_dssp161THHHHHHHHSTTCC-CSTTTSCTTBEEEEECTTSCEEEEECCCSSSSCEEEEEEEGGGHHHHHHHHHHHTGGGTCEECCH240 (388)
Q ss_pred241CCCCHHHHHHCCCCCCCCCCCCCCCCC----------------------------CCCCEEEECCC--------------320 (388)
Q d20180514_4241AARDTLYLLAGANLYGCMWDEPIGPLA----------------------------ANGGITIPWEP--------------320 (388)
T 1VRQ_A241ETMHVLRAEKGFIIVGQDTDGTVTPQDAGMEWVVSKLKDFVGKRSFSREDNVREDRKHLVSVLPVDSSLRLAEGAALVAA320 (388)
T ss_pred241HHHHHHHHHHHHHHCCCCCCCCCCHHHCCCHHHHCCCCCCCCHHHHHHHHHCCCCCEEEEEEEEECCCCCCCCCCEEECC320 (388)
T ss_dssp241HHHHHHHHTTTCCCTTTTCCSSCCTTTTTCGGGSCSSSCCTTGGGGGSTGGGCTTCCEEEEEEESSTTCCCCTTCEEEET320 (388)
Q ss_pred321-------------------------------------CC-------------CCCCCHHHHHHHHHCC388 (388)
Q d20180514_4321-------------------------------------AI-------------MDFCGREATEMGVEHG388 (388)
T 1VRQ_A321DAVASEGVTPMEGWVTHAYNSPALGRTFGLALIKNGRNRIGEVLKTPVDGQLVDVQVSDL-VLFDPEG388 (388)
T ss_pred321CCCCCCCCCCEEEEEECCCCCCCCCCEEEEEEECHHHCCCCCEEEEEECCEEEEEEEECC-CCCCCCC388 (388)
T ss_dssp321TCCCBTTBCCCCEEEEEEEEETTTTEEEEEEEETTGGGCTTCEEEEEETTEEEEEEEECS-CCSCTTC388 (388)