TreeThreader - Results

  Job information

Job ID: d20180514
#Proteins: 4
Protein ID: d20180514_2
Fasta ID: seq2
Submission time: 2018-05-14 10:54:02 +0800
Finished time: 2018-05-14 14:19:37 +0800
Identical Job(s): NULL

  Alignments

1
50
100
150
200
250
274
3A8I_A 3A8I_A 3A8K_A 3A8K_A 1VLO_A 1VLO_A 1YX2_A 1YX2_A 1WOS_A 1WOS_A 1V5V_A 1V5V_A 1WSV_A 1WSV_A 3GIR_A 3GIR_A 2GAH_A 2GAH_A 1VRQ_A 1VRQ_A

  Build multi-template model (choose up to 5 templates)

                   
Download full-length structure

  Top 10 hits

Query:
Job ID  : d20180514_2
Length : 274
Sequence: LTPHYEFHTTNYARNVQFCGWSTPLQYGSLVDTFIAARTDHTHFDVCHETIVVLRGVNTRRFDRYLLANDVACPTKSIKW LMIECLNHIGGVIDDLIKYYFYEDFFRLVVTSATIPKDQSWIKTHIEPFEIEQTVRGGLQFLAVQGKNAQAKGATCDADA QRQKAEGSSPFFGVQAGDLVIADTGYTGLAGYFIALPNPKCADKWKGLVHASSNPCPLGARDTLRLEAGASRYGAEIHKT ISPLAAMRGWTIAWEPAGPDFIGREALESQREHG

No Hit MAC Score Identity Cols Query HMM Template HMM
13A8I_A192.660.592741-2744-363
23A8K_A192.550.592741-2744-363
31VLO_A191.360.592741-27416-375
41YX2_A173.970.282721-2747-361
51WOS_A173.20.282731-2743-359
61V5V_A163.110.232721-2747-394
71WSV_A161.180.242721-2747-371
83GIR_A159.560.262681-27435-389
92GAH_A157.570.172721-274576-960
101VRQ_A156.340.172721-274575-959

  Pairwise Query-Template Alignment

No 1
> 3A8I_A        Alignment in PIR format
MAC score = 192.66	Identity = 0.59

Download partial structureDownload full-length structure
Q ss_pred1CCCCCHHHHHCCCEEECCCCCCCCCCCCCHHHHHHHHHHCCCEEECCCCCEEEEECCCHHHHHHHHCCCCCCCCCCCCEE80 (360)
Q d20180514_21LTPHYEFHTTNYARNVQFCGWSTPLQYGSLVDTFIAARTDHTHFDVCHETIVVLRGVNTRRFDRYLLANDVACPTKSIKW80 (360)
T 3A8I_A1QTPLYEQHTLCGARMVDFHGWMMPLHYGSQIDEHHAVRTDAGMFDVSHMTIVDLRGSRTREFLRYLLANDVAKLTKSGKA80 (360)
T ss_pred1CCCCHHHHHHCCCEEEEECCEECCCCCCCHHHHHHHHHHCCEEEECCCCEEEEEECCCHHHHHHHHCCCCHHHCCCCCEE80 (360)
T ss_dssp1CCTTHHHHHHTTCEEEECSSBEEEEESSCHHHHHHHHHHSCEEEECTTSEEEEEESTTHHHHHHHHCSSCGGGCCSTTBE80 (360)
Q ss_pred81EEEEEECCCCCEEEEEEEEEEECCEEEEEECCCCHHHHHHHHHHHCCCCCEEEEEECCEEEEECCCCCHHHHCCCCCHHH160 (360)
Q d20180514_281LMIECLNHIGGVIDDLIKYYFYEDFFRLVVTSATIPKDQSWIKTHIEPFEIEQTVRGGLQFLAVQGKNAQAKGATCDADA160 (360)
T 3A8I_A81LYSGMLNASGGVIDDLIVYYFTEDFFRLVVNSATREKDLSWITQHAEPFGIEITVRDDLSMIAVQGPNAQAKAATLFNDA160 (360)
T ss_pred81EEEEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHCCCCCCEEEECCCEEEEEEECHHHHHHHHHHCCHH160 (360)
T ss_dssp81EEEEEECTTSCEEEEEEEEEEETTEEEEEECSTTHHHHHHHHHHHHGGGTCEEEEETTEEEEEEESTTHHHHHHTTCCHH160 (360)
Q ss_pred161HHHHHCCCCCEEEEECCCEEEEEECCCCCCCEEEECCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC240 (360)
Q d20180514_2161QRQKAEGSSPFFGVQAGDLVIADTGYTGLAGYFIALPNPKCADKWKGLVHASSNPCPLGARDTLRLEAGASRYGAEIHKT240 (360)
T 3A8I_A161QRQAVEGMKPFFGVQAGDLFIATTGYTGEAGYEIALPNEKAADFWRALVEAGVKPCGLGARDTLRLEAGMNLYGQEMDET240 (360)
T ss_pred161HHHCCCCCCEEEEECCEEEEEEECCCCCCCEEEEEECHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCCCCCCC240 (360)
T ss_dssp161HHHHHTTCCSSBEEEETTEEEECCCSSSSCEEEEEEEHHHHHHHHHHHHHTTCEECCHHHHHHHHHHHTCCCBTTTBCTT240 (360)
Q ss_pred241CCHHCCC-------------------------------------------------------------------------320 (360)
Q d20180514_2241ISPLAAM-------------------------------------------------------------------------320 (360)
T 3A8I_A241ISPLAANMGWTIAWEPADRDFIGREALEVQREHGTEKLVGLVMTEKGVLRNELPVRFTDAQGNQHEGIITSGTFSPTLGY320 (360)
T ss_pred241CCHHHCCCHHHHCCCCCCCCCCCHHHHHHHHHCCCEEEEEEEECCCCCCCCCCEEEECCCCCCEEEEEEECCCCCCCCCC320 (360)
T ss_dssp241SCGGGTTCGGGCCCCSTTCCCTTHHHHHHHHHHCCCEEEEEEECSSSCCCTTCEEEEECTTSCEEEEEEEEEEEETTTTE320 (360)
Q ss_pred321CCCEEEECCCCC------------CCCCHHH-HHHHHHCC360 (360)
Q d20180514_2321RGWTIAWEPAGP------------DFIGREA-LESQREHG360 (360)
T 3A8I_A321SIALARVPEGIGETAIVQIRNREMPVKVTKPVFVRNGKAV360 (360)
T ss_pred321EEEEEEECCCCCCEEEEEECCEEEEEEEEECCCCCCCCCC360 (360)
T ss_dssp321EEEEEEECTTCCSEEEEEETTEEEEEEEECSCSEETTEEC360 (360)


No 2
> 3A8K_A        Alignment in PIR format
MAC score = 192.55	Identity = 0.59

Download partial structureDownload full-length structure
Q ss_pred1CCCCCHHHHHCCCEEECCCCCCCCCCCCCHHHHHHHHHHCCCEEECCCCCEEEEECCCHHHHHHHHCCCCCCCCCCCCEE80 (360)
Q d20180514_21LTPHYEFHTTNYARNVQFCGWSTPLQYGSLVDTFIAARTDHTHFDVCHETIVVLRGVNTRRFDRYLLANDVACPTKSIKW80 (360)
T 3A8K_A1QTPLYEQHTLCGARMVDFHGWMMPLHYGSQIDEHHAVRTDAGMFDVSHMTIVDLRGSRTREFLRYLLANDVAKLTKSGKA80 (360)
T ss_pred1CCCCHHHHHHCCCEEEEECCEECCCCCCCHHHHHHHHHHCCEEEECCCCEEEEEECCCHHHHHHHHCCCCHHHCCCCCEE80 (360)
T ss_dssp1ECTTHHHHHHTTCEEEEETTEEEEEESSCHHHHHHHHHHSCEEEECTTSEEEEEESTTHHHHHHHHCSSCGGGCCSTTBE80 (360)
Q ss_pred81EEEEEECCCCCEEEEEEEEEEECCEEEEEECCCCHHHHHHHHHHHCCCCCEEEEEECCEEEEECCCCCHHHHCCCCCHHH160 (360)
Q d20180514_281LMIECLNHIGGVIDDLIKYYFYEDFFRLVVTSATIPKDQSWIKTHIEPFEIEQTVRGGLQFLAVQGKNAQAKGATCDADA160 (360)
T 3A8K_A81LYSGMLNASGGVIDNLIVYYFTEDFFRLVVNSATREKDLSWITQHAEPFGIEITVRDDLSMIAVQGPNAQAKAATLFNDA160 (360)
T ss_pred81EEEEEECCCCCEEEEEEEEEEECCEEEEEECCCCHHHHHHHHHHHCCCCCCEEEEECCEEEEEEECHHHHHHHHHHCCCH160 (360)
T ss_dssp81EEEEEECTTSCEEEEEEEEEEETTEEEEEECSTTHHHHHHHHHHHHGGGTCEEEEETTEEEEEEESTTHHHHHHTTSCHH160 (360)
Q ss_pred161HHHHHCCCCCEEEEECCCEEEEEECCCCCCCEEEECCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC240 (360)
Q d20180514_2161QRQKAEGSSPFFGVQAGDLVIADTGYTGLAGYFIALPNPKCADKWKGLVHASSNPCPLGARDTLRLEAGASRYGAEIHKT240 (360)
T 3A8K_A161QRQAVEGMKPFFGVQAGDLFIATTGYTGEAGYEIALPNEKAADFWRALVEAGVKPCGLGARDTLRLEAGMNLYGQEMDET240 (360)
T ss_pred161HHHCCCCCCEEEEECCEEEEEEECCCCCCCEEEEEECHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCCCCCCC240 (360)
T ss_dssp161HHHHHTTCCSSBEEEETTEEEECCCSSSSCEEEEEEEHHHHHHHHHHHHHTTCEECCHHHHHHHHHHTTCCCBTTTBCTT240 (360)
Q ss_pred241CCHHCCC-------------------------------------------------------------------------320 (360)
Q d20180514_2241ISPLAAM-------------------------------------------------------------------------320 (360)
T 3A8K_A241ISPLAANMGWTIAWEPADRDFIGREALEVQREHGTEKLVGLVMTEKGVLRNELPVRFTDAQGNQHEGIITSGTFSPTLGY320 (360)
T ss_pred241CCHHHCCCHHHHCCCCCCCCCCCHHHHHHHHCCCCEEEEEEEECCCCCCCCCCEEEECCCCCCEEEEEEECCCCCCCCCC320 (360)
T ss_dssp241SCGGGTTCGGGCCCCSTTCCCTTHHHHHHHHHHCCCEEEEEEECSSSCCCTTCEEEEECTTSCEEEEEEEEEEEETTTTE320 (360)
Q ss_pred321CCCEEEECCCCC----------C--CCCHHH-HHHHHHCC360 (360)
Q d20180514_2321RGWTIAWEPAGP----------D--FIGREA-LESQREHG360 (360)
T 3A8K_A321SIALARVPEGIGETAIVQIRNREMPVKVTKPVFVRNGKAV360 (360)
T ss_pred321EEEEEEECCCCCCEEEEEECCEEEEEEEEECCCCCCCCCC360 (360)
T ss_dssp321EEEEEEECTTCCSEEEEECSSSEEEEEEECSCCEETTEEC360 (360)


No 3
> 1VLO_A    Aminomethyltransferase; NP417381, tetrahydrofolat dependent) of glycine cleavage system, structural genomics, protein structure initiative; HET: MSE; 1.70A {Escherichia coli K12} SCOP: b.44.2.1 d.250.1.1 PDB: 3a8j_A* 3a8i_A* 3a8k_A*     Alignment in PIR format
MAC score = 191.36	Identity = 0.59

Download partial structureDownload full-length structure
Q ss_pred1CCCCCHHHHHCCCEEECCCCCCCCCCCCCHHHHHHHHHHCCCEEECCCCCEEEEECCCHHHHHHHHCCCCCCCCCCCCEE80 (360)
Q d20180514_21LTPHYEFHTTNYARNVQFCGWSTPLQYGSLVDTFIAARTDHTHFDVCHETIVVLRGVNTRRFDRYLLANDVACPTKSIKW80 (360)
T 1VLO_A1QTPLYEQHTLCGARMVDFHGWMMPLHYGSQIDEHHAVRTDAGMFDVSHMTIVDLRGSRTREFLRYLLANDVAKLTKSGKA80 (360)
T ss_pred1CCCHHHHHHHCCCEEEEECCEECCEECCCHHHHHHHHHCCEEEEECCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCE80 (360)
T ss_dssp1CCTTHHHHHHTTCEEEEETTEEEEEESSCHHHHHHHHHHSCEEEECTTSEEEEEESTTHHHHHHHHBSSCGGGCCSTTBE80 (360)
Q ss_pred81EEEEEECCCCCEEEEEEEEEEECCEEEEEECCCCHHHHHHHHHHHCCCCCEEEEEECCEEEEECCCCCHHHHCCCCCHHH160 (360)
Q d20180514_281LMIECLNHIGGVIDDLIKYYFYEDFFRLVVTSATIPKDQSWIKTHIEPFEIEQTVRGGLQFLAVQGKNAQAKGATCDADA160 (360)
T 1VLO_A81LYSGMLNASGGVIDDLIVYYFTEDFFRLVVNSATREKDLSWITQHAEPFGIEITVRDDLSMIAVQGPNAQAKAATLFNDA160 (360)
T ss_pred81EEEEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHCCCCCEEEEECCCEEEEEEECCCCHHHHHHHHHHC160 (360)
T ss_dssp81EEEEEECTTSCEEEEEEEEEEETTEEEEEECGGGHHHHHHHHHHHHGGGTCEEEECTTEEEEEEESTTHHHHHHTTCCHH160 (360)
Q ss_pred161HHHHHCCCCCEEEEECCCEEEEEECCCCCCCEEEECCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC240 (360)
Q d20180514_2161QRQKAEGSSPFFGVQAGDLVIADTGYTGLAGYFIALPNPKCADKWKGLVHASSNPCPLGARDTLRLEAGASRYGAEIHKT240 (360)
T 1VLO_A161QRQAVEGMKPFFGVQAGDLFIATTGYTGEAGYEIALPNEKAADFWRALVEAGVKPCGLGARDTLRLEAGMNLYGQEMDET240 (360)
T ss_pred161CCCCHHHCCCCEEEEECCEEEEECCCCCCCEEEEEECHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCCCCCCCCCC240 (360)
T ss_dssp161HHHHHTTCCSSBEEEETTEEEECCCSSSSCEEEEEEEHHHHHHHHHHHHHTTCEECCHHHHHHHHHHTTCCCBTTTBCTT240 (360)
Q ss_pred241CCHHCCC-------------------------------------------------------------------------320 (360)
Q d20180514_2241ISPLAAM-------------------------------------------------------------------------320 (360)
T 1VLO_A241ISPLAANMGWTIAWEPADRDFIGREALEVQREHGTEKLVGLVMTEKGVLRNELPVRFTDAQGNQHEGIITSGTFSPTLGY320 (360)
T ss_pred241CCHHHCCCCCEECCCCCCCCCCCHHHHHHHHHCCCCEEEEEEECCCCCCCCCCEEEECCCCCCEEEEEEEEEEECCCCCC320 (360)
T ss_dssp241SCGGGTTCGGGCCCCSTTCCCTTHHHHHHHHHHCCCEEEEEEECSSSCCCTTCEEEEECTTCCEEEEEEEEEEEETTTTE320 (360)
Q ss_pred321CCCEEEECCCCC-CC-----------CCHHH-HHHHHHCC360 (360)
Q d20180514_2321RGWTIAWEPAGP-DF-----------IGREA-LESQREHG360 (360)
T 1VLO_A321SIALARVPEGIGETAIVQIRNREMPVKVTKPVFVRNGKAV360 (360)
T ss_pred321EEEEEEEECCCCCEEEEEECCEEEEEEEEECCCCCCCCEE360 (360)
T ss_dssp321EEEEEEECTTCCSEEEEEETTEEEEEEEECSCCEETTEEC360 (360)


No 4
> 1YX2_A    Aminomethyltransferase; glycine cleavage system T protein, alpha-beta, beta-barrel, structural genomics, PSI, protein structure initiative; 2.08A {Bacillus subtilis}     Alignment in PIR format
MAC score = 173.97	Identity = 0.28

Download partial structureDownload full-length structure
Q ss_pred1CCCCCHHHHHCCCEEECCCCCCCCCCCCCHHHHHHHHHHCCCEEECCCCCEEEEECCCHHHHHHHHCCCCCCCCCCCCEE80 (357)
Q d20180514_21LTPHYEFHTTNYARNVQFCGWSTPLQYGSLVDTFIAARTDHTHFDVCHETIVVLRGVNTRRFDRYLLANDVACPTKSIKW80 (357)
T 1YX2_A1RTPLFDLYKEYGGKTIDFGGWELPVQFSSIKKEHEAVRTAAGLFDVSHMGEVEVSGNDSLSFLQRLMTNDVSALT-PGRA80 (357)
T ss_pred1CCCCHHHHHHCCCEEEEECCEECCCCCCCHHHHHHHHHHCEEEEECCCCEEEEEECCCHHHHHHHHCCCCCCCCC-CCCE80 (357)
T ss_dssp1CCTTGGGHHHHTCEEEEETTEEEEEESSCHHHHHHHHHHSEEEEECTTSEEEEEESTTHHHHHHHHBSSCGGGCC-TTBE80 (357)
Q ss_pred81EEEEEECCCCCEEEEEEEEEEECCEEEEEECCCCHHHHHHHHHHHCCCCCEEE-EEECCEEEEECCCCCHHHHCCCCCH-160 (357)
Q d20180514_281LMIECLNHIGGVIDDLIKYYFYEDFFRLVVTSATIPKDQSWIKTHIEPFEIEQ-TVRGGLQFLAVQGKNAQAKGATCDA-160 (357)
T 1YX2_A81QYTAMCYPDGGTVDDLLIYQKGENRYLLVINASNIDKDLAWMKEHAAG-DVQIDNQSDQIALLAVQGPKAEAILKNLTDA160 (357)
T ss_pred81EEEEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHCCC-CEEEEECCCCEEEEEEECCCHHHHHHHHHCC160 (357)
T ss_dssp81EEEEEECTTSCEEEEEEEEEEETTEEEEEECGGGHHHHHHHHHHTCCS-SCEEEECTTTEEEEEEESTTHHHHHHTTBSS160 (357)
Q ss_pred161HHHHHHHCCCCCEEEEECCCEEEEEECCCCCCCEEEECCCHHHHHHHHHHHHC----CCCCCCCCCCCCCCCCCCCCCCC240 (357)
Q d20180514_2161DAQRQKAEGSSPFFGVQAGDLVIADTGYTGLAGYFIALPNPKCADKWKGLVHA----SSNPCPLGARDTLRLEAGASRYG240 (357)
T 1YX2_A161DVSALKPFAFIDEADISGRKALISRTGYTGEDGYEIYCRSDDAMHIWKKIIDAGDAYGLIPCGLGARDTLRFEANIPLYG240 (357)
T ss_pred161CCCCCCCCEEEEEEEECCCEEEEEECCCCCCCEEEEEECHHHHHHHHHHHHHCCHHCCCEECCHHHHHHHHHHCCCCCCC240 (357)
T ss_dssp161CGGGCCTTBEEEEEEETTEEEEEESCCSSSSSEEEEEEEGGGHHHHHHHHHHHHGGGTEEEECHHHHHHHHHHTTCCCBT240 (357)
Q ss_pred241CCCCCCCCHHCCC-----------------------------CCCEEEE-------------------------------320 (357)
Q d20180514_2241AEIHKTISPLAAM-----------------------------RGWTIAW-------------------------------320 (357)
T 1YX2_A241QELTRDITPIEAGIGFAVKHKKESDFFGKSVLSEQKENGAKRKLVGLEMIEKGIPRHGYEVFQNGKSVGKVTTGTQSPTL320 (357)
T ss_pred241CCCCCCCCHHHCCCCCEECCCCCCCCCCHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCEEEECCCEEEEEECCCCCCCC320 (357)
T ss_dssp241TTBSTTCCTTTTTCGGGCCTTCSSCCTTHHHHHHHHHHCCSEEEEEEEESSSCCCCTTCEEEETTEEEEEEEEEEEETTT320 (357)
Q ss_pred321---------CC---CCC-CCCCHH----HHHHHHHCC357 (357)
Q d20180514_2321---------EP---AGP-DFIGRE----ALESQREHG357 (357)
T 1YX2_A321GKNVGLALIDSETSEIGTVVDVEIRKKLVKAKVVKTP357 (357)
T ss_pred321CCEEEEEEECHHHCCCCCEEEEEECCEEEEEEEEECC357 (357)
T ss_dssp321TEEEEEEEEEGGGCSTTCEEEEEETTEEEEEEEECCC357 (357)


No 5
> 1WOS_A    Aminomethyltransferase; T-protein; 1.84A {Thermotoga maritima} SCOP: b.44.2.1 d.250.1.1 PDB: 1woo_A* 1wop_A* 1wor_A     Alignment in PIR format
MAC score = 173.2	Identity = 0.28

Download partial structureDownload full-length structure
Q ss_pred1CCCCCHHHHHCCCEEECCCCCCCCCCCCCHHHHHHHHHHCCCEEECCCCCEEEEECCCHHHHHHHHCCCCCCCCCCCCEE80 (358)
Q d20180514_21LTPHYEFHTTNYARNVQFCGWSTPLQYGSLVDTFIAARTDHTHFDVCHETIVVLRGVNTRRFDRYLLANDVACPTKSIKW80 (358)
T 1WOS_A1RTPLFEKHVELGAKMVDFAGWEMPLYYTSIFEEVMAVRKSVGMFDVSHMGEFLVKGPEAVSFIDFLITNDFSSLP-DGKA80 (358)
T ss_pred1CCCCHHHHHHCCCEEEEECCEECCEECCCHHHHHHHHHHCEEEEECCCCEEEEEECCCHHHHHHHHCCCCCCCCC-CCCE80 (358)
T ss_dssp1CCTTHHHHHHTTCEEEEETTEEEEEESSCHHHHHHHHHHSCEEEECTTSEEEEEESTTHHHHHHHHBSSCCTTCC-TTEE80 (358)
Q ss_pred81EEEEEECCCCCEEEEEEEEEEECCEEEEEECCCCHHHHHHHHHHHCCCCCEEEEEE-CCEEEEECCCCCHHHHCCCCCHH160 (358)
Q d20180514_281LMIECLNHIGGVIDDLIKYYFYEDFFRLVVTSATIPKDQSWIKTHIEPFEIEQTVR-GGLQFLAVQGKNAQAKGATCDAD160 (358)
T 1WOS_A81IYSVMCNENGGIIDDLVVYKVSPDEALMVVNAANIEKDFNWIKSHSKNFDVEVSNISDTTALIAFQGPKAQETLQELVED160 (358)
T ss_pred81EEEEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHCCCCCCEEEEECCCEEEEEEECCCHHHHHHHHHCC160 (358)
T ss_dssp81EEEEEECTTSCEEEEEEEEEEETTEEEEEECGGGHHHHHHHHHTTCTTSSCEEEECGGGEEEEEEESTTHHHHHGGGBSS160 (358)
Q ss_pred161HHHHHHCCCCCEEEEECCCEEEEEECCCCCCCEEEECCCHHHHHHHHHHHHC----CCCCCCCCCCCCCCCCCCCCCCCC240 (358)
Q d20180514_2161AQRQKAEGSSPFFGVQAGDLVIADTGYTGLAGYFIALPNPKCADKWKGLVHA----SSNPCPLGARDTLRLEAGASRYGA240 (358)
T 1WOS_A161GLEEIAYYSFRKSIVAGVETLVSRTGYTGEDGFELMLEAKNAPKVWDALMNLLRKIDGRPAGLGARDVCRLEATYLLYGQ240 (358)
T ss_pred161CHHHCCCCEEEEEEECCCEEEEEECCCCCCCEEEEEECHHHHHHHHHHHHHCCCCCCCEECCHHHHHHHHHHCCCCCCCC240 (358)
T ss_dssp161CSTTSCTTBEEEEEETTEEEEEESCCSSSSSEEEEEEEGGGHHHHHHHHHHHHHHHTCEECCHHHHHHHHHHTTCCCBTT240 (358)
Q ss_pred241CCCCCCCHHCCC------------------------------------------------------------------CC320 (358)
Q d20180514_2241EIHKTISPLAAM------------------------------------------------------------------RG320 (358)
T 1WOS_A241DMDENTNPFEVGLSWVVKLNKDFVGKEALLKAKEKVERKLVALELSGKRIARKGYEVLKNGERVGEITSGNFSPTLGKSI320 (358)
T ss_pred241CCCCCCCHHHCCCCCCCCCCCCCCCHHHHHHHHCCCCEEEEEEEECCCCCCCCCCEEEECCCEEEEEECCCCCCCCCCEE320 (358)
T ss_dssp241TBCTTSCGGGGTCGGGCCTTSCCTTHHHHHHHHHTCCEEEEEEEESSSCCCCTTCEEEETTEEEEEEEEEEEETTTTEEE320 (358)
Q ss_pred321CEEEECCCCC---CC--CC-------HHHHHH-HHHCC358 (358)
Q d20180514_2321WTIAWEPAGP---DF--IG-------REALES-QREHG358 (358)
T 1WOS_A321ALALVSKSVKIGDQLGVVFPGGKLVEALVVKKPFYRGS358 (358)
T ss_pred321EEEEECCCCCCCCEEEEEECCCCEEEEEEEECCCCCCC358 (358)
T ss_dssp321EEEEEETTCCTTCEEEEEETTTEEEEEEEECSCSCCCS358 (358)


No 6
> 1V5V_A    Aminomethyltransferase; glycine-cleavage sytem, structural riken structural genomics/proteomics initiative, RSGI; 1.50A {Pyrococcus horikoshii} SCOP: b.44.2.1 d.250.1.1     Alignment in PIR format
MAC score = 163.11	Identity = 0.23

Download partial structureDownload full-length structure
Q ss_pred1CCCCCHHHHHCCCEEECCCCCCCCCCCCCHHHHHHHHHHCCCEEECCCCCEEEEECCCHHHHHHHHCCCCCCCCCCCCEE80 (390)
Q d20180514_21LTPHYEFHTTNYARNVQFCGWSTPLQYGSLVDTFIAARTDHTHFDVCHETIVVLRGVNTRRFDRYLLANDVACPTKSIKW80 (390)
T 1V5V_A1RVHIFDWHKEHARKIEEFAGWEMPIWYSSIKEEHLAVRNAVGIFDVSHMGEIVFRGKDALKFLQYVTTNDISKPP-AISG80 (390)
T ss_pred1CCCCHHHHHHCCCEEEEECCEECCEECCCHHHHHHHHHHCEEEEECCCCEEEEEECCCHHHHHHHHCCCCCCCCC-CCCE80 (390)
T ss_dssp1CCTTHHHHHHHCSEEEEETTEEEEEESSCHHHHHHHHHHSCEEEECTTSEEEEEESTTHHHHHHHHSSSCTTSSC-SSEE80 (390)
Q ss_pred81EEEEEECCCCCEEEEEEEEEEECCEEEEEECCCCHHHHHHHHHHHCCCCC------EEEEEE-CCEEEEECCCCCHHHHC160 (390)
Q d20180514_281LMIECLNHIGGVIDDLIKYYFYEDFFRLVVTSATIPKDQSWIKTHIEPFE------IEQTVR-GGLQFLAVQGKNAQAKG160 (390)
T 1V5V_A81TYTLVLNERGAIKDETLVFNMGNNEYLMICDSDAFEKLYAWFTYLKRTIEQFTKLDLEIELKTYDIAMFAVQGPKARDLA160 (390)
T ss_pred81EEEEEECCCCCEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCEEEEEEECCCHHHHH160 (390)
T ss_dssp81EEEEEECTTSCEEEEEEEEEEETTEEEEEECTTTHHHHHHHHHHHHHHHHTTSCCCCEEEECTTTEEEEEEESTTHHHHH160 (390)
Q ss_pred161CCCCHHHHHHHHCCCCCEEEEECCCEEEEEECCCCCCCEEEECC--------------CHHHHHHHHHHHHC----CCCC240 (390)
Q d20180514_2161ATCDADAQRQKAEGSSPFFGVQAGDLVIADTGYTGLAGYFIALP--------------NPKCADKWKGLVHA----SSNP240 (390)
T 1V5V_A161KDLFGIDINEMWWFQARWVELDGIKMLLSRSGYTGENGFEVYIEDANPYHPDESKRGEPEKALHVWERILEEGKKYGIKP240 (390)
T ss_pred161HHHHCCCCCCCCCCEEEEEEECCEEEEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEE240 (390)
T ss_dssp161HHHHSCCGGGSCTTBEEEEEETTEEEEEECCCSSSSCEEEEEEECCCTTCSSGGGCCCCHHHHHHHHHHHHHHGGGTCEE240 (390)
Q ss_pred241CCCCCCCCCCCCCCCCCCCCCCC--------------------------CCCCHHC------------------------320 (390)
Q d20180514_2241CPLGARDTLRLEAGASRYGAEIH--------------------------KTISPLA------------------------320 (390)
T 1V5V_A241CGLGARDTLRLEAGYTLYGNETKELQLLSTDIDEVTPLQANLEFAIYWDKDFIGKDALLKQKERGVGRKLVHFKMIDKGI320 (390)
T ss_pred241CCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCCCCCCHHHHHHHHHCCCCEEEEEEEECCCCC320 (390)
T ss_dssp241ECHHHHHHHHHHHTCCCBTTTBCCCCCSSCSCCSSCTTTTTCGGGCCTTSCCTTHHHHHHHHHHCCCEEEEEEEESSSCC320 (390)
Q ss_pred321--------------------------CCCCCEEEECC--CCC-------------CCCCHHHHHHHHHCC390 (390)
Q d20180514_2321--------------------------AMRGWTIAWEP--AGP-------------DFIGREALESQREHG390 (390)
T 1V5V_A321PREGYKVYANGEMIGEVTSGTLSPLLNVGIGIAFVKEEYAKPGIEIEVEIRGQRKKAVTVTP-PFYDPKK390 (390)
T ss_pred321CCCCCEEEECCCCEEEEECCCCCCCCCCEEEEEEECHHHCCCCCEEEEEECCEEEEEEEEEC-CCCCCCC390 (390)
T ss_dssp321CCTTCEEEETTEEEEEEEEEEECTTTCSEEEEEEEEGGGCSTTCEEEEEETTEEEEEEEECS-CSSCTTT390 (390)


No 7
> 1WSV_A        Alignment in PIR format
MAC score = 161.18	Identity = 0.24

Download partial structureDownload full-length structure
Q ss_pred1CCCCCHHHHHCCCEEECCCCCCCCCCC-CCHHHHHHHHHHCCCEEECCCCCEEEEECCCHHHHHHHHCCCCCCCCCCCCE80 (367)
Q d20180514_21LTPHYEFHTTNYARNVQFCGWSTPLQY-GSLVDTFIAARTDHTHFDVCHETIVVLRGVNTRRFDRYLLANDVACPTKSIK80 (367)
T 1WSV_A1RTPLYDFHLAHGGKMVAFAGWSLPVQYRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELR-PNQ80 (367)
T ss_pred1CCCCHHHHHHCCCEEEEECCEECCCCCCCHHHHHHHHHHHCCEEEECCCCEEEEEECCCHHHHHHHHCCCCCCCCC-CCE80 (367)
T ss_dssp1CCTTHHHHHHTTCCEEEETTEEEESCCSSCHHHHHHHHHHSEEEEECTTSEEEEEESTTHHHHHHTTBSSCCTTCC-TTE80 (367)
Q ss_pred81EEEEEEECCCCCEEEEEEEEEEECCEEEEEECCCCHHHHHHHHHHHCCCCC---E-EEEEECCEEEEECCCCCHHHHCCC160 (367)
Q d20180514_281WLMIECLNHIGGVIDDLIKYYFYEDFFRLVVTSATIPKDQSWIKTHIEPFE---I-EQTVRGGLQFLAVQGKNAQAKGAT160 (367)
T 1WSV_A81GTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQA160 (367)
T ss_pred81EEEEEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCEEEEEEECHHHHHHHHH160 (367)
T ss_dssp81EEEEEEECTTCCEEEEEEEEECTTSSEEEEECGGGHHHHHHHHHHHHHHHHTTTCCCEEEECCCEEEEEESTTHHHHHHT160 (367)
Q ss_pred161CCHHHHHHHHCCCCCEE-EEECCCEEEEEECCCCCCCEEEECCCHHHHHHHHHHHHCC-CCCCCCCCCCCCCCCCCCCCC240 (367)
Q d20180514_2161CDADAQRQKAEGSSPFF-GVQAGDLVIADTGYTGLAGYFIALPNPKCADKWKGLVHAS-SNPCPLGARDTLRLEAGASRY240 (367)
T 1WSV_A161GVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLY240 (367)
T ss_pred161HCCCCHHHCCCCEEEEEEECCCCCEEEECCCCCCCCEEEEEECHHHHHHHHHHHHHCCCCEEECHHHHHHHHHHHHHHHC240 (367)
T ss_dssp161TCSSCGGGSCTTBEEEEEETTEEEEEEESCCSSSSSEEEEEECHHHHHHHHHHHHTSTTEEECCHHHHHHHHHHTTCCCB240 (367)
Q ss_pred241CCCCCCCCCHHCC-------------------------------------------------------------------320 (367)
Q d20180514_2241GAEIHKTISPLAA-------------------------------------------------------------------320 (367)
T 1WSV_A241GNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPS320 (367)
T ss_pred241CCCCCCCCCHHHCCCHHHCCCCCCCCCCCCCHHHHHHHHHCCCCEEEEEEEEECCCCCCCCCEECCCCEEEEEEEECEEC320 (367)
T ss_dssp241TTTBCTTCCTTTTTCGGGSCHHHHHHTCSTTHHHHHHHHTTCCSEEEEEEEESSSCCCTTCEEECTTSCEEEEEEEEEEE320 (367)
Q ss_pred321-----CCCCEEEECC--CCC-CC-----------CCHHHHHHHHHCC367 (367)
Q d20180514_2321-----MRGWTIAWEP--AGP-DF-----------IGREALESQREHG367 (367)
T 1WSV_A321PSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKM-PFVPTNY367 (367)
T ss_pred321CCCCCEEEEEEECCHHCCCCCEEEEEECCEEEEEEEEEC-CCCCCCC367 (367)
T ss_dssp321TTTTEEEEEEEEEGGGCSTTCEEEEECSSSEEEEEEECS-CSSCCCC367 (367)


No 8
> 3GIR_A    Aminomethyltransferase; glycine cleavage system, aminotransferase, structural genomics; 1.60A {Bartonella henselae}     Alignment in PIR format
MAC score = 159.56	Identity = 0.26

Download partial structureDownload full-length structure
Q ss_pred1CCCCCHHHHHCCCEEECCCCCCCCCCC-CCHHHHHHHHHHCCCEEECCCCCEEEEECCCHHHHHHHHCCCCCCCCCCCCE80 (361)
Q d20180514_21LTPHYEFHTTNYARNVQFCGWSTPLQY-GSLVDTFIAARTDHTHFDVCHETIVVLRGVNTRRFDRYLLANDVACPTKSIK80 (361)
T 3GIR_A1TLPLYELHEKAGAKFGAFAGWRMPLTYPLGVLKEHLHTRAHAGLFDISHMKLIAVEGPKAVEFLSYALPVDAALLK-IGQ80 (361)
T ss_pred1CCCCHHHHHHCCCEEEEECCEEECCCCCCCHHHHHHHHHCCCEEEECCCCEEEEEECCCHHHHHHHHCCCCCCCCC-CCC80 (361)
T ss_dssp1ECTTHHHHHHTTCEEEEETTEEEEEECTTCHHHHHHHHHHSEEEEECTTSEEEEEESTTHHHHHHHHSSSCTTTSC-TTB80 (361)
Q ss_pred81EEEEEEECCCCCEEEEEEEEEEECCEEEEEECCCCHHHHHHHHHHHCCCCCEEEEEECCEEEEECCCCCHHHHCCCCCHH160 (361)
Q d20180514_281WLMIECLNHIGGVIDDLIKYYFYEDFFRLVVTSATIPKDQSWIKTHIEPFEIEQTVRGGLQFLAVQGKNAQAKGATCDAD160 (361)
T 3GIR_A81SRYSYLLNERAGILDDLILTRLAECRFMLVANAGNAQADFAELEKRAFGFECQVIA-LERVLLALQGPQAAAVLADAGLP160 (361)
T ss_pred81EEEEEEECCCCCEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHCCCCCEEEEE-CCCEEEEEECCCHHHHHHHHCCC160 (361)
T ss_dssp81EEEEEEECTTCCEEEEEEEEEEETTEEEEEECGGGHHHHHHHHHHHTTTSSCEEEE-CCCEEEEEESTTHHHHHHHTTCC160 (361)
Q ss_pred161HHHHHHCCCCCEEEEECCCEEEEEECCCCCCCEEEECCCHHHHHHHHHHHHCC-CCCCCCCCCCCCCCCCCCCCCCCCCC240 (361)
Q d20180514_2161AQRQKAEGSSPFFGVQAGDLVIADTGYTGLAGYFIALPNPKCADKWKGLVHAS-SNPCPLGARDTLRLEAGASRYGAEIH240 (361)
T 3GIR_A161GNE-L--LFM-QGFEPQQDWFITRSGYTGEDGFEIALPIGCARALAEKLLGDSRVEWVGLAARDSLRLEAGLCLHGNDIT240 (361)
T ss_pred161HHH-C--CCC-EEEECCCEEEEEECCCCCCCEEEEEEEHHHHHHHHHHHHHCCCCEECCHHHHHHHHHHCCCCCCCCCCC240 (361)
T ss_dssp161CTT-C--CTT-BEECSSTTCEEESCCSSSSSEEEEEECHHHHHHHHHHHHTSTTEEECCHHHHHHHHHHTTCCCBTTTBC240 (361)
Q ss_pred241CCCCHHCC------------------------------------------------------------------------320 (361)
Q d20180514_2241KTISPLAA------------------------------------------------------------------------320 (361)
T 3GIR_A241PDTTPIDAALTWAVPKNVREKAQFYGAKAFLESLQKGPSRCRVGLKPQTRQPIRAGAVLFDNEGNRIGVVTSGGFGPSFD320 (361)
T ss_pred241CCCCHHHCCCCCEECCCCCCCCCCCCHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCEEECCCCEEECEEECCCCCCCCC320 (361)
T ss_dssp241TTCCTTTTTCGGGSCHHHHHHCCSTTHHHHHHHHHHCCSSEEEEEEESSSSCCCTTCEEECTTSCEEEEEEEEEEETTTT320 (361)
Q ss_pred321CCCCEEEECCCCC-------------CCCCHHHHHHHHHCC361 (361)
Q d20180514_2321MRGWTIAWEPAGP-------------DFIGREALESQREHG361 (361)
T 3GIR_A321GPVAMGYVPVAWKVEGTEVFTELRGKKIALSVHSLPFVEQR361 (361)
T ss_pred321CEEEEEEECHHHCCCCCEEEEEECCEEEEEEEEECCCCCCC361 (361)
T ss_dssp321EEEEEEEECGGGCSTTCEEEEEETTEEEEEEEECSCSSCCC361 (361)


No 9
> 2GAH_A        Alignment in PIR format
MAC score = 157.57	Identity = 0.17

Download partial structureDownload full-length structure
Q ss_pred1CCCCCHHHHHCCCEEECCCCCCCCCCC--------CCHHHHHHHHHHCCCEEECCCCCEEEEECCCHHHHHHHHCCCCCC80 (387)
Q d20180514_21LTPHYEFHTTNYARNVQFCGWSTPLQY--------GSLVDTFIAARTDHTHFDVCHETIVVLRGVNTRRFDRYLLANDVA80 (387)
T 2GAH_A1ITAMHSWHLSHGAEFEDVGQWKRPWYYPQAGETMDQAVYRESKAVRDSVGMLDATTLGKIEIRGKDAAEFLNRIYTNGYT80 (387)
T ss_pred1CCCCHHHHHHCCCEEEEECCEECCCCCCCCCCCHHHHHHHHHHHHHHCCEEEECCCCEEEEEECCCHHHHHHHHCCCCCC80 (387)
T ss_dssp1CCTTHHHHHHTTCEEEEETTEEEEEECCCTTCCHHHHHHHHHHHHHHSCEEEECTTSEEEEEESTTHHHHHHHHBSSCCT80 (387)
Q ss_pred81CCCCCCEEEEEEEECCCCCEEEEEEEEEEECCEEEEEECCCCHHHHHHHHHHHCCCCC----EEEE-EECCEEEEECCCC160 (387)
Q d20180514_281CPTKSIKWLMIECLNHIGGVIDDLIKYYFYEDFFRLVVTSATIPKDQSWIKTHIEPFE----IEQT-VRGGLQFLAVQGK160 (387)
T 2GAH_A81KLK-VGMGRYGVMCKADGMIFDDGVTLRLAEDRFLLHTTTGGAADVLDWLEEWLQTEWPDLDVTCTSVTEQLATVAVVGP160 (387)
T ss_pred81CCC-CCEEEEEEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCEEEEEECCH160 (387)
T ss_dssp81TCC-TTBEEEEEEECTTCCEEEEEEEEEEETTEEEEEECTTTHHHHHHHHHHHHHHTCTTSCCEEEECTTTEEEEEEEST160 (387)
Q ss_pred161CHHHHCCCCCHHH-HH--HHHCCCCCEEEEE-CCCEEEEEECCCCCCCEEEECCCHHHHHHHHHHHHCCC----CCCCCC240 (387)
Q d20180514_2161NAQAKGATCDADA-QR--QKAEGSSPFFGVQ-AGDLVIADTGYTGLAGYFIALPNPKCADKWKGLVHASS----NPCPLG240 (387)
T 2GAH_A161RSRDVIAKLASTVDVSNEGFKFMAFKDVVLDSGIEARISRISFSGELAFEIAVPAWHGLRVWEDVYAAGEEFNITPYGTE240 (387)
T ss_pred161HHHHHHHHHCCCCCCCHHHCCCCEEEEEEEECCCEEEEEEECCCCCCEEEEEECHHHHHHHHHHHHHCCHHCCCEEEEHH240 (387)
T ss_dssp161THHHHHHHHCTTSCCSTTTSCTTBEEEEECTTSCEEEEECCCSSSSCEEEEEEEGGGHHHHHHHHHHHTGGGTCEECCHH240 (387)
Q ss_pred241CCCCCCCCCCCCCCCCCCCCCCC---------------------------------------------------------320 (387)
Q d20180514_2241ARDTLRLEAGASRYGAEIHKTIS---------------------------------------------------------320 (387)
T 2GAH_A241TMHVLRAEKGFIIVGQDTDGTVTPQDAGMEWVVSKLKDFIGNRSYSRADNAREDRKQLVSVLPVDKSLRLPEGAALVASD320 (387)
T ss_pred241HHHHHHHHHHHHHCCCCCCCCCCHHHCCCHHHHCCCCCCCCHHHHHHHHHCCCCCEEEEEEEEECCCCCCCCCCEEECCC320 (387)
T ss_dssp241HHHHHHHHTTCCCTTTTCCSSCCTTTTTCGGGSCSSSCCTTGGGGGSGGGGCSCCEEEEEEEESSTTCCCCTTCEEEETT320 (387)
Q ss_pred321--------------------HHCCCCCCEEEECC--C-CC------------CCCCHHHHHHHHHCC387 (387)
Q d20180514_2321--------------------PLAAMRGWTIAWEP--A-GP------------DFIGREALESQREHG387 (387)
T 2GAH_A321ALASEGITPMEGWVTSSYDSPNLGRTFGLALIKNGRNRIGEVLKTPVGDQLVDVVVSET-VLYDPEG387 (387)
T ss_pred321CCCCCCCCCEEEEEECCCCCCCCCCEEEEEEECHHHCCCCCEEEEEECCEEEEEEEECC-CCCCCCC387 (387)
T ss_dssp321CCCBTTBCCCCEEEEEEEEETTTTEEEEEEEEETGGGCTTCEEEEEETTEEEEEEEECS-CCSSTTC387 (387)


No 10
> 1VRQ_A        Alignment in PIR format
MAC score = 156.34	Identity = 0.17

Download partial structureDownload full-length structure
Q ss_pred1CCCCCHHHHHCCCEEECCCCCCCCCCC--------CCHHHHHHHHHHCCCEEECCCCCEEEEECCCHHHHHHHHCCCCCC80 (387)
Q d20180514_21LTPHYEFHTTNYARNVQFCGWSTPLQY--------GSLVDTFIAARTDHTHFDVCHETIVVLRGVNTRRFDRYLLANDVA80 (387)
T 1VRQ_A1LTAMHPWHLAHGAKFEDVGQWKRPWYYPQDGESMDEAVYRECKAVRDSVGMLDASTLGKIEIRGKDAAEFLNRMYTNGYT80 (387)
T ss_pred1CCCHHHHHHHCCCEEEEECCEECCCCCCCCCCCHHHHHHHHHHHHHHCCEEEECCCCEEEEEECCCHHHHHHHHCCCCCC80 (387)
T ss_dssp1CCTTHHHHHHTTCEEEEETTEEEEEECCCTTCCHHHHHHHHHHHHHHSCEEEECTTSEEEEEESTTHHHHHHHHBSSCCT80 (387)
Q ss_pred81CCCCCCEEEEEEEECCCCCEEEEEEEEEEECCEEEEEECCCCHHHHHHHHHHHCCCCC----EEEE-EECCEEEEECCCC160 (387)
Q d20180514_281CPTKSIKWLMIECLNHIGGVIDDLIKYYFYEDFFRLVVTSATIPKDQSWIKTHIEPFE----IEQT-VRGGLQFLAVQGK160 (387)
T 1VRQ_A81KLK-VGMGRYGVMCKADGMIFDDGVTLRLAEDRFLMHTTTGGAADVLDWLEEWLQTEWPELDVTCTSVTEQLATVAVVGP160 (387)
T ss_pred81CCC-CCEEEEEEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCEEEEEECCH160 (387)
T ss_dssp81TCC-TTBEEEEEEECTTSCEEEEEEEEEEETTEEEEEECTTTHHHHHHHHHHHHHHTCTTSCCEEEECTTTEEEEEEEST160 (387)
Q ss_pred161CHHHHCCCCCHHH---HHHHHCCCCCEEEEE-CCCEEEEEECCCCCCCEEEECCCHHHHHHHHHHHHCCCC----CCCCC240 (387)
Q d20180514_2161NAQAKGATCDADA---QRQKAEGSSPFFGVQ-AGDLVIADTGYTGLAGYFIALPNPKCADKWKGLVHASSN----PCPLG240 (387)
T 1VRQ_A161RSRDVIAKLASSLDVSNDAFKFMAFQDVTLDSGIEARISRISFSGELAFEIAIPAWHGLQVWEDVYAAGQEFNITPYGTE240 (387)
T ss_pred161HHHHHHHHHCCCCCCCHHHCCCCEEEEEEEECCCEEEEEEECCCCCCEEEEEECHHHHHHHHHHHHHCCHHCCCEEEEHH240 (387)
T ss_dssp161THHHHHHHHSTTCCCSTTTSCTTBEEEEECTTSCEEEEECCCSSSSCEEEEEEEGGGHHHHHHHHHHHTGGGTCEECCHH240 (387)
Q ss_pred241CCCCCCCCCCCCCCCCCCCCCCCHHC------------------------------------------------------320 (387)
Q d20180514_2241ARDTLRLEAGASRYGAEIHKTISPLA------------------------------------------------------320 (387)
T 1VRQ_A241TMHVLRAEKGFIIVGQDTDGTVTPQDAGMEWVVSKLKDFVGKRSFSREDNVREDRKHLVSVLPVDSSLRLAEGAALVAAD320 (387)
T ss_pred241HHHHHHHHHHHHHCCCCCCCCCCHHHCCCHHHHCCCCCCCCHHHHHHHHHCCCCCEEEEEEEEECCCCCCCCCCEEECCC320 (387)
T ss_dssp241HHHHHHHTTTCCCTTTTCCSSCCTTTTTCGGGSCSSSCCTTGGGGGSTGGGCTTCCEEEEEEESSTTCCCCTTCEEEETT320 (387)
Q ss_pred321----------------------CCCCCE-EEECC--C--CCCC-----------CCHHHHHHHHHCC387 (387)
Q d20180514_2321----------------------AMRGWT-IAWEP--A--GPDF-----------IGREALESQREHG387 (387)
T 1VRQ_A321AVASEGVTPMEGWVTHAYNSPALGRTFGLALIKNGRNRIGEVLKTPVDGQLVDVQVSDL-VLFDPEG387 (387)
T ss_pred321CCCCCCCCCEEEEEECCCCCCCCCCEEEEEEECHHHCCCCCEEEEEECCEEEEEEEECC-CCCCCCC387 (387)
T ss_dssp321CCCBTTBCCCCEEEEEEEEETTTTEEEEEEEETTGGGCTTCEEEEEETTEEEEEEEECS-CCSCTTC387 (387)