TreeThreader - Results

  Job information

Job ID: d20180514
#Proteins: 4
Protein ID: d20180514_1
Fasta ID: seq1
Submission time: 2018-05-14 10:54:02 +0800
Finished time: 2018-05-14 14:32:27 +0800
Identical Job(s): NULL

  Alignments

1
50
100
150
200
250
274
1VLO_A 1VLO_A 3A8K_A 3A8K_A 3A8I_A 3A8I_A 1WOS_A 1WOS_A 1YX2_A 1YX2_A 1V5V_A 1V5V_A 1WSV_A 1WSV_A 2GAH_A 2GAH_A 3GIR_A 3GIR_A 1VRQ_A 1VRQ_A

  Build multi-template model (choose up to 5 templates)

                   
Download full-length structure

  Top 10 hits

Query:
Job ID  : d20180514_1
Length : 274
Sequence: QTPLYEQHTSKGGRAVDDHGPMHEGHYASYIDEHHAERTDEMVMWKSHVTIVDLRMSDCREDLRYQLAWDVAKLTKSGKA LYSICLNCSGGVEQDLLVYYFYDDFCRLVVNSATRTKDLSHITQHIELFLIEITMRDELSMIIVQNPNATAGHNTCFNDA LMQAVEGFLPFFSVQAGDLAIITTGYTPKAGYERAWPSVKANDFWRALVEAFVKDCGLGARDTLGLTAMPNHFGQATFET ITPLWANSGGTIAWEPARRDFIGRIALEVQRKPG

No Hit MAC Score Identity Cols Query HMM Template HMM
11VLO_A195.610.632741-27416-375
23A8K_A195.510.642741-2744-363
33A8I_A195.190.632741-2744-363
41WOS_A175.720.272731-2743-358
51YX2_A175.140.282731-2747-362
61V5V_A163.380.212731-2747-397
71WSV_A161.780.232731-2747-374
82GAH_A160.750.162731-274576-961
93GIR_A159.660.262681-27435-389
101VRQ_A158.470.152731-274575-959

  Pairwise Query-Template Alignment

No 1
> 1VLO_A    Aminomethyltransferase; NP417381, tetrahydrofolat dependent) of glycine cleavage system, structural genomics, protein structure initiative; HET: MSE; 1.70A {Escherichia coli K12} SCOP: b.44.2.1 d.250.1.1 PDB: 3a8j_A* 3a8i_A* 3a8k_A*     Alignment in PIR format
MAC score = 195.61	Identity = 0.63

Download partial structureDownload full-length structure
Q ss_pred1CCCCHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCEEEEECCCHHHHHHHHHCCCCCCCCCCCCE80 (360)
Q d20180514_11QTPLYEQHTSKGGRAVDDHGPMHEGHYASYIDEHHAERTDEMVMWKSHVTIVDLRMSDCREDLRYQLAWDVAKLTKSGKA80 (360)
T 1VLO_A1QTPLYEQHTLCGARMVDFHGWMMPLHYGSQIDEHHAVRTDAGMFDVSHMTIVDLRGSRTREFLRYLLANDVAKLTKSGKA80 (360)
T ss_pred1CCCHHHHHHHCCCEEEEECCEECCEECCCHHHHHHHHHCCEEEEECCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCE80 (360)
T ss_dssp1CCTTHHHHHHTTCEEEEETTEEEEEESSCHHHHHHHHHHSCEEEECTTSEEEEEESTTHHHHHHHHBSSCGGGCCSTTBE80 (360)
Q ss_pred81EECEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHCCCCCEEEEECCCCHHHCCCCCCHHHHHHHHCHHH160 (360)
Q d20180514_181LYSICLNCSGGVEQDLLVYYFYDDFCRLVVNSATRTKDLSHITQHIELFLIEITMRDELSMIIVQNPNATAGHNTCFNDA160 (360)
T 1VLO_A81LYSGMLNASGGVIDDLIVYYFTEDFFRLVVNSATREKDLSWITQHAEPFGIEITVRDDLSMIAVQGPNAQAKAATLFNDA160 (360)
T ss_pred81EEEEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHCCCCCEEEEECCCEEEEEEECCCCHHHHHHHHHHC160 (360)
T ss_dssp81EEEEEECTTSCEEEEEEEEEEETTEEEEEECGGGHHHHHHHHHHHHGGGTCEEEECTTEEEEEEESTTHHHHHHTTCCHH160 (360)
Q ss_pred161HHHHHHCCCCEEEEECCCEEEEECCCCCCCCEEEEEECCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC240 (360)
Q d20180514_1161LMQAVEGFLPFFSVQAGDLAIITTGYTPKAGYERAWPSVKANDFWRALVEAFVKDCGLGARDTLGLTAMPNHFGQATFET240 (360)
T 1VLO_A161QRQAVEGMKPFFGVQAGDLFIATTGYTGEAGYEIALPNEKAADFWRALVEAGVKPCGLGARDTLRLEAGMNLYGQEMDET240 (360)
T ss_pred161CCCCHHHCCCCEEEEECCEEEEECCCCCCCEEEEEECHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCCCCCCCCCC240 (360)
T ss_dssp161HHHHHTTCCSSBEEEETTEEEECCCSSSSCEEEEEEEHHHHHHHHHHHHHTTCEECCHHHHHHHHHHTTCCCBTTTBCTT240 (360)
Q ss_pred241CCCCCC-------------------------------------------------------------------------C320 (360)
Q d20180514_1241ITPLWA-------------------------------------------------------------------------N320 (360)
T 1VLO_A241ISPLAANMGWTIAWEPADRDFIGREALEVQREHGTEKLVGLVMTEKGVLRNELPVRFTDAQGNQHEGIITSGTFSPTLGY320 (360)
T ss_pred241CCHHHCCCCCEECCCCCCCCCCCHHHHHHHHHCCCCEEEEEEECCCCCCCCCCEEEECCCCCCEEEEEEEEEEECCCCCC320 (360)
T ss_dssp241SCGGGTTCGGGCCCCSTTCCCTTHHHHHHHHHHCCCEEEEEEECSSSCCCTTCEEEEECTTCCEEEEEEEEEEEETTTTE320 (360)
Q ss_pred321CCCEEEECCCC------------CCCCCHHH-HHHHHCCC360 (360)
Q d20180514_1321SGGTIAWEPAR------------RDFIGRIA-LEVQRKPG360 (360)
T 1VLO_A321SIALARVPEGIGETAIVQIRNREMPVKVTKPVFVRNGKAV360 (360)
T ss_pred321EEEEEEEECCCCCEEEEEECCEEEEEEEEECCCCCCCCEE360 (360)
T ss_dssp321EEEEEEECTTCCSEEEEEETTEEEEEEEECSCCEETTEEC360 (360)


No 2
> 3A8K_A        Alignment in PIR format
MAC score = 195.51	Identity = 0.64

Download partial structureDownload full-length structure
Q ss_pred1CCCCHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCEEEEECCCHHHHHHHHHCCCCCCCCCCCCE80 (360)
Q d20180514_11QTPLYEQHTSKGGRAVDDHGPMHEGHYASYIDEHHAERTDEMVMWKSHVTIVDLRMSDCREDLRYQLAWDVAKLTKSGKA80 (360)
T 3A8K_A1QTPLYEQHTLCGARMVDFHGWMMPLHYGSQIDEHHAVRTDAGMFDVSHMTIVDLRGSRTREFLRYLLANDVAKLTKSGKA80 (360)
T ss_pred1CCCCHHHHHHCCCEEEEECCEECCCCCCCHHHHHHHHHHCCEEEECCCCEEEEEECCCHHHHHHHHCCCCHHHCCCCCEE80 (360)
T ss_dssp1ECTTHHHHHHTTCEEEEETTEEEEEESSCHHHHHHHHHHSCEEEECTTSEEEEEESTTHHHHHHHHCSSCGGGCCSTTBE80 (360)
Q ss_pred81EECEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHCCCCCEEEEECCCCHHHCCCCCCHHHHHHHHCHHH160 (360)
Q d20180514_181LYSICLNCSGGVEQDLLVYYFYDDFCRLVVNSATRTKDLSHITQHIELFLIEITMRDELSMIIVQNPNATAGHNTCFNDA160 (360)
T 3A8K_A81LYSGMLNASGGVIDNLIVYYFTEDFFRLVVNSATREKDLSWITQHAEPFGIEITVRDDLSMIAVQGPNAQAKAATLFNDA160 (360)
T ss_pred81EEEEEECCCCCEEEEEEEEEEECCEEEEEECCCCHHHHHHHHHHHCCCCCCEEEEECCEEEEEEECHHHHHHHHHHCCCH160 (360)
T ss_dssp81EEEEEECTTSCEEEEEEEEEEETTEEEEEECSTTHHHHHHHHHHHHGGGTCEEEEETTEEEEEEESTTHHHHHHTTSCHH160 (360)
Q ss_pred161HHHHHHCCCCEEEEECCCEEEEECCCCCCCCEEEEEECCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC240 (360)
Q d20180514_1161LMQAVEGFLPFFSVQAGDLAIITTGYTPKAGYERAWPSVKANDFWRALVEAFVKDCGLGARDTLGLTAMPNHFGQATFET240 (360)
T 3A8K_A161QRQAVEGMKPFFGVQAGDLFIATTGYTGEAGYEIALPNEKAADFWRALVEAGVKPCGLGARDTLRLEAGMNLYGQEMDET240 (360)
T ss_pred161HHHCCCCCCEEEEECCEEEEEEECCCCCCCEEEEEECHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCCCCCCC240 (360)
T ss_dssp161HHHHHTTCCSSBEEEETTEEEECCCSSSSCEEEEEEEHHHHHHHHHHHHHTTCEECCHHHHHHHHHHTTCCCBTTTBCTT240 (360)
Q ss_pred241CCCCCCC-------------------------------------------------------------------------320 (360)
Q d20180514_1241ITPLWAN-------------------------------------------------------------------------320 (360)
T 3A8K_A241ISPLAANMGWTIAWEPADRDFIGREALEVQREHGTEKLVGLVMTEKGVLRNELPVRFTDAQGNQHEGIITSGTFSPTLGY320 (360)
T ss_pred241CCHHHCCCHHHHCCCCCCCCCCCHHHHHHHHCCCCEEEEEEEECCCCCCCCCCEEEECCCCCCEEEEEEECCCCCCCCCC320 (360)
T ss_dssp241SCGGGTTCGGGCCCCSTTCCCTTHHHHHHHHHHCCCEEEEEEECSSSCCCTTCEEEEECTTSCEEEEEEEEEEEETTTTE320 (360)
Q ss_pred321CCCEEEECCC----------CCC--CCCHH-HHHHHHCCC360 (360)
Q d20180514_1321SGGTIAWEPA----------RRD--FIGRI-ALEVQRKPG360 (360)
T 3A8K_A321SIALARVPEGIGETAIVQIRNREMPVKVTKPVFVRNGKAV360 (360)
T ss_pred321EEEEEEECCCCCCEEEEEECCEEEEEEEEECCCCCCCCCC360 (360)
T ss_dssp321EEEEEEECTTCCSEEEEECSSSEEEEEEECSCCEETTEEC360 (360)


No 3
> 3A8I_A        Alignment in PIR format
MAC score = 195.19	Identity = 0.63

Download partial structureDownload full-length structure
Q ss_pred1CCCCHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCEEEEECCCHHHHHHHHHCCCCCCCCCCCCE80 (360)
Q d20180514_11QTPLYEQHTSKGGRAVDDHGPMHEGHYASYIDEHHAERTDEMVMWKSHVTIVDLRMSDCREDLRYQLAWDVAKLTKSGKA80 (360)
T 3A8I_A1QTPLYEQHTLCGARMVDFHGWMMPLHYGSQIDEHHAVRTDAGMFDVSHMTIVDLRGSRTREFLRYLLANDVAKLTKSGKA80 (360)
T ss_pred1CCCCHHHHHHCCCEEEEECCEECCCCCCCHHHHHHHHHHCCEEEECCCCEEEEEECCCHHHHHHHHCCCCHHHCCCCCEE80 (360)
T ss_dssp1CCTTHHHHHHTTCEEEECSSBEEEEESSCHHHHHHHHHHSCEEEECTTSEEEEEESTTHHHHHHHHCSSCGGGCCSTTBE80 (360)
Q ss_pred81EECEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHCCCCCEEEEECCCCHHHCCCCCCHHHHHHHHCHHH160 (360)
Q d20180514_181LYSICLNCSGGVEQDLLVYYFYDDFCRLVVNSATRTKDLSHITQHIELFLIEITMRDELSMIIVQNPNATAGHNTCFNDA160 (360)
T 3A8I_A81LYSGMLNASGGVIDDLIVYYFTEDFFRLVVNSATREKDLSWITQHAEPFGIEITVRDDLSMIAVQGPNAQAKAATLFNDA160 (360)
T ss_pred81EEEEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHCCCCCCEEEECCCEEEEEEECHHHHHHHHHHCCHH160 (360)
T ss_dssp81EEEEEECTTSCEEEEEEEEEEETTEEEEEECSTTHHHHHHHHHHHHGGGTCEEEEETTEEEEEEESTTHHHHHHTTCCHH160 (360)
Q ss_pred161HHHHHHCCCCEEEEECCCEEEEECCCCCCCCEEEEEECCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC240 (360)
Q d20180514_1161LMQAVEGFLPFFSVQAGDLAIITTGYTPKAGYERAWPSVKANDFWRALVEAFVKDCGLGARDTLGLTAMPNHFGQATFET240 (360)
T 3A8I_A161QRQAVEGMKPFFGVQAGDLFIATTGYTGEAGYEIALPNEKAADFWRALVEAGVKPCGLGARDTLRLEAGMNLYGQEMDET240 (360)
T ss_pred161HHHCCCCCCEEEEECCEEEEEEECCCCCCCEEEEEECHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCCCCCCC240 (360)
T ss_dssp161HHHHHTTCCSSBEEEETTEEEECCCSSSSCEEEEEEEHHHHHHHHHHHHHTTCEECCHHHHHHHHHHHTCCCBTTTBCTT240 (360)
Q ss_pred241CCCCC-------------------------------------CC------------------------------------320 (360)
Q d20180514_1241ITPLW-------------------------------------AN------------------------------------320 (360)
T 3A8I_A241ISPLAANMGWTIAWEPADRDFIGREALEVQREHGTEKLVGLVMTEKGVLRNELPVRFTDAQGNQHEGIITSGTFSPTLGY320 (360)
T ss_pred241CCHHHCCCHHHHCCCCCCCCCCCHHHHHHHHHCCCEEEEEEEECCCCCCCCCCEEEECCCCCCEEEEEEECCCCCCCCCC320 (360)
T ss_dssp241SCGGGTTCGGGCCCCSTTCCCTTHHHHHHHHHHCCCEEEEEEECSSSCCCTTCEEEEECTTSCEEEEEEEEEEEETTTTE320 (360)
Q ss_pred321CCCEEEECCC------------CCCCCCHH-HHHHHHCCC360 (360)
Q d20180514_1321SGGTIAWEPA------------RRDFIGRI-ALEVQRKPG360 (360)
T 3A8I_A321SIALARVPEGIGETAIVQIRNREMPVKVTKPVFVRNGKAV360 (360)
T ss_pred321EEEEEEECCCCCCEEEEEECCEEEEEEEEECCCCCCCCCC360 (360)
T ss_dssp321EEEEEEECTTCCSEEEEEETTEEEEEEEECSCSEETTEEC360 (360)


No 4
> 1WOS_A    Aminomethyltransferase; T-protein; 1.84A {Thermotoga maritima} SCOP: b.44.2.1 d.250.1.1 PDB: 1woo_A* 1wop_A* 1wor_A     Alignment in PIR format
MAC score = 175.72	Identity = 0.27

Download partial structureDownload full-length structure
Q ss_pred1CCCCHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCEEEEECCCHHHHHHHHHCCCCCCCCCCCCE80 (357)
Q d20180514_11QTPLYEQHTSKGGRAVDDHGPMHEGHYASYIDEHHAERTDEMVMWKSHVTIVDLRMSDCREDLRYQLAWDVAKLTKSGKA80 (357)
T 1WOS_A1RTPLFEKHVELGAKMVDFAGWEMPLYYTSIFEEVMAVRKSVGMFDVSHMGEFLVKGPEAVSFIDFLITNDFSSL-PDGKA80 (357)
T ss_pred1CCCCHHHHHHCCCEEEEECCEECCEECCCHHHHHHHHHHCEEEEECCCCEEEEEECCCHHHHHHHHCCCCCCCC-CCCCE80 (357)
T ss_dssp1CCTTHHHHHHTTCEEEEETTEEEEEESSCHHHHHHHHHHSCEEEECTTSEEEEEESTTHHHHHHHHBSSCCTTC-CTTEE80 (357)
Q ss_pred81EECEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHCCCCCEEEEE-CCCCHHHCCCCCCHHHHHHHHCHH160 (357)
Q d20180514_181LYSICLNCSGGVEQDLLVYYFYDDFCRLVVNSATRTKDLSHITQHIELFLIEITM-RDELSMIIVQNPNATAGHNTCFND160 (357)
T 1WOS_A81IYSVMCNENGGIIDDLVVYKVSPDEALMVVNAANIEKDFNWIKSHSKNFDVEVSNISDTTALIAFQGPKAQETLQELVED160 (357)
T ss_pred81EEEEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHCCCCCCEEEEECCCEEEEEEECCCHHHHHHHHHCC160 (357)
T ss_dssp81EEEEEECTTSCEEEEEEEEEEETTEEEEEECGGGHHHHHHHHHTTCTTSSCEEEECGGGEEEEEEESTTHHHHHGGGBSS160 (357)
Q ss_pred161HHHHHHHCCCCEEEEECCCEEEEECCCCCCCCEEEEEECCCHHHHHHHHHHC----CCCCCCCCCCCCCCCCCCCCCCCC240 (357)
Q d20180514_1161ALMQAVEGFLPFFSVQAGDLAIITTGYTPKAGYERAWPSVKANDFWRALVEA----FVKDCGLGARDTLGLTAMPNHFGQ240 (357)
T 1WOS_A161GLEEIAYYSFRKSIVAGVETLVSRTGYTGEDGFELMLEAKNAPKVWDALMNLLRKIDGRPAGLGARDVCRLEATYLLYGQ240 (357)
T ss_pred161CHHHCCCCEEEEEEECCCEEEEEECCCCCCCEEEEEECHHHHHHHHHHHHHCCCCCCCEECCHHHHHHHHHHCCCCCCCC240 (357)
T ss_dssp161CSTTSCTTBEEEEEETTEEEEEESCCSSSSSEEEEEEEGGGHHHHHHHHHHHHHHHTCEECCHHHHHHHHHHTTCCCBTT240 (357)
Q ss_pred241CCCCCCCCCCC-----------------------------------------------------C-------------CC320 (357)
Q d20180514_1241ATFETITPLWA-----------------------------------------------------N-------------SG320 (357)
T 1WOS_A241DMDENTNPFEVGLSWVVKLNKDFVGKEALLKAKEKVERKLVALELSGKRIARKGYEVLKNGERVGEITSGNFSPTLGKSI320 (357)
T ss_pred241CCCCCCCHHHCCCCCCCCCCCCCCCHHHHHHHHCCCCEEEEEEEECCCCCCCCCCEEEECCCEEEEEECCCCCCCCCCEE320 (357)
T ss_dssp241TBCTTSCGGGGTCGGGCCTTSCCTTHHHHHHHHHTCCEEEEEEEESSSCCCCTTCEEEETTEEEEEEEEEEEETTTTEEE320 (357)
Q ss_pred321CEEEECCC-CC--C--CCC-------HHHHHHHHCCC357 (357)
Q d20180514_1321GTIAWEPA-RR--D--FIG-------RIALEVQRKPG357 (357)
T 1WOS_A321ALALVSKSVKIGDQLGVVFPGGKLVEALVVKKPFYRG357 (357)
T ss_pred321EEEEECCCCCCCCEEEEEECCCCEEEEEEEECCCCCC357 (357)
T ss_dssp321EEEEEETTCCTTCEEEEEETTTEEEEEEEECSCSCCC357 (357)


No 5
> 1YX2_A    Aminomethyltransferase; glycine cleavage system T protein, alpha-beta, beta-barrel, structural genomics, PSI, protein structure initiative; 2.08A {Bacillus subtilis}     Alignment in PIR format
MAC score = 175.14	Identity = 0.28

Download partial structureDownload full-length structure
Q ss_pred1CCCCHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCEEEEECCCHHHHHHHHHCCCCCCCCCCCCE80 (357)
Q d20180514_11QTPLYEQHTSKGGRAVDDHGPMHEGHYASYIDEHHAERTDEMVMWKSHVTIVDLRMSDCREDLRYQLAWDVAKLTKSGKA80 (357)
T 1YX2_A1RTPLFDLYKEYGGKTIDFGGWELPVQFSSIKKEHEAVRTAAGLFDVSHMGEVEVSGNDSLSFLQRLMTNDVSALT-PGRA80 (357)
T ss_pred1CCCCHHHHHHCCCEEEEECCEECCCCCCCHHHHHHHHHHCEEEEECCCCEEEEEECCCHHHHHHHHCCCCCCCCC-CCCE80 (357)
T ss_dssp1CCTTGGGHHHHTCEEEEETTEEEEEESSCHHHHHHHHHHSEEEEECTTSEEEEEESTTHHHHHHHHBSSCGGGCC-TTBE80 (357)
Q ss_pred81EECEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHCCCCCEEEEECCCCHHHCCCCCCHHHHHHHHCHHH160 (357)
Q d20180514_181LYSICLNCSGGVEQDLLVYYFYDDFCRLVVNSATRTKDLSHITQHIELFLIEITMRDELSMIIVQNPNATAGHNTCFNDA160 (357)
T 1YX2_A81QYTAMCYPDGGTVDDLLIYQKGENRYLLVINASNIDKDLAWMKEHAAGDVQIDNQSDQIALLAVQGPKAEAILKNLTDAD160 (357)
T ss_pred81EEEEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHCCCCEEEEECCCCEEEEEEECCCHHHHHHHHHCCC160 (357)
T ss_dssp81EEEEEECTTSCEEEEEEEEEEETTEEEEEECGGGHHHHHHHHHHTCCSSCEEEECTTTEEEEEEESTTHHHHHHTTBSSC160 (357)
Q ss_pred161HHHHHH-CCCCEEEEECCCEEEEECCCCCCCCEEEEEECCCHHHHHHHHHHC----CCCCCCCCCCCCCCCCCCCCCCCC240 (357)
Q d20180514_1161LMQAVE-GFLPFFSVQAGDLAIITTGYTPKAGYERAWPSVKANDFWRALVEA----FVKDCGLGARDTLGLTAMPNHFGQ240 (357)
T 1YX2_A161VSALKPFAFIDEADISGRKALISRTGYTGEDGYEIYCRSDDAMHIWKKIIDAGDAYGLIPCGLGARDTLRFEANIPLYGQ240 (357)
T ss_pred161CCCCCCCEEEEEEEECCCEEEEEECCCCCCCEEEEEECHHHHHHHHHHHHHCCHHCCCEECCHHHHHHHHHHCCCCCCCC240 (357)
T ss_dssp161GGGCCTTBEEEEEEETTEEEEEESCCSSSSSEEEEEEEGGGHHHHHHHHHHHHGGGTEEEECHHHHHHHHHHTTCCCBTT240 (357)
Q ss_pred241CCCCCCCCCCCCC-------------------------------------------------------------------320 (357)
Q d20180514_1241ATFETITPLWANS-------------------------------------------------------------------320 (357)
T 1YX2_A241ELTRDITPIEAGIGFAVKHKKESDFFGKSVLSEQKENGAKRKLVGLEMIEKGIPRHGYEVFQNGKSVGKVTTGTQSPTLG320 (357)
T ss_pred241CCCCCCCHHHCCCCCEECCCCCCCCCCHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCEEEECCCEEEEEECCCCCCCCC320 (357)
T ss_dssp241TBSTTCCTTTTTCGGGCCTTCSSCCTTHHHHHHHHHHCCSEEEEEEEESSSCCCCTTCEEEETTEEEEEEEEEEEETTTT320 (357)
Q ss_pred321--CCEEEECCC---CC-CCCCHH----HHHHHHC-CC357 (357)
Q d20180514_1321--GGTIAWEPA---RR-DFIGRI----ALEVQRK-PG357 (357)
T 1YX2_A321KNVGLALIDSETSEIGTVVDVEIRKKLVKAKVVKTPF357 (357)
T ss_pred321CEEEEEEECHHHCCCCCEEEEEECCEEEEEEEEECCC357 (357)
T ss_dssp321EEEEEEEEEGGGCSTTCEEEEEETTEEEEEEEECCCC357 (357)


No 6
> 1V5V_A    Aminomethyltransferase; glycine-cleavage sytem, structural riken structural genomics/proteomics initiative, RSGI; 1.50A {Pyrococcus horikoshii} SCOP: b.44.2.1 d.250.1.1     Alignment in PIR format
MAC score = 163.38	Identity = 0.21

Download partial structureDownload full-length structure
Q ss_pred1CCCCHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCEEEEECCCHHHHHHHHHCCCCCCCCCCCCE80 (392)
Q d20180514_11QTPLYEQHTSKGGRAVDDHGPMHEGHYASYIDEHHAERTDEMVMWKSHVTIVDLRMSDCREDLRYQLAWDVAKLTKSGKA80 (392)
T 1V5V_A1RVHIFDWHKEHARKIEEFAGWEMPIWYSSIKEEHLAVRNAVGIFDVSHMGEIVFRGKDALKFLQYVTTNDISKPP-AISG80 (392)
T ss_pred1CCCCHHHHHHCCCEEEEECCEECCEECCCHHHHHHHHHHCEEEEECCCCEEEEEECCCHHHHHHHHCCCCCCCCC-CCCE80 (392)
T ss_dssp1CCTTHHHHHHHCSEEEEETTEEEEEESSCHHHHHHHHHHSCEEEECTTSEEEEEESTTHHHHHHHHSSSCTTSSC-SSEE80 (392)
Q ss_pred81EECEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHCCC------CCEEEEEC-CCCHHHCCCCCCHHHHH160 (392)
Q d20180514_181LYSICLNCSGGVEQDLLVYYFYDDFCRLVVNSATRTKDLSHITQHIEL------FLIEITMR-DELSMIIVQNPNATAGH160 (392)
T 1V5V_A81TYTLVLNERGAIKDETLVFNMGNNEYLMICDSDAFEKLYAWFTYLKRTIEQFTKLDLEIELKTYDIAMFAVQGPKARDLA160 (392)
T ss_pred81EEEEEECCCCCEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCEEEEEEECCCHHHHH160 (392)
T ss_dssp81EEEEEECTTSCEEEEEEEEEEETTEEEEEECTTTHHHHHHHHHHHHHHHHTTSCCCCEEEECTTTEEEEEEESTTHHHHH160 (392)
Q ss_pred161HHHCHHHHHHHHHCCCCEEEEECCCEEEEECCCCCCCCEEEEEECC--------------CHHHHHHHHHHC----CCCC240 (392)
Q d20180514_1161NTCFNDALMQAVEGFLPFFSVQAGDLAIITTGYTPKAGYERAWPSV--------------KANDFWRALVEA----FVKD240 (392)
T 1V5V_A161KDLFGIDINEMWWFQARWVELDGIKMLLSRSGYTGENGFEVYIEDANPYHPDESKRGEPEKALHVWERILEEGKKYGIKP240 (392)
T ss_pred161HHHHCCCCCCCCCCEEEEEEECCEEEEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEE240 (392)
T ss_dssp161HHHHSCCGGGSCTTBEEEEEETTEEEEEECCCSSSSCEEEEEEECCCTTCSSGGGCCCCHHHHHHHHHHHHHHGGGTCEE240 (392)
Q ss_pred241CCCCCCCCCCCCCCCCCCCCCC--------------------------CCCCCC--------------------------320 (392)
Q d20180514_1241CGLGARDTLGLTAMPNHFGQAT--------------------------FETITP--------------------------320 (392)
T 1V5V_A241CGLGARDTLRLEAGYTLYGNETKELQLLSTDIDEVTPLQANLEFAIYWDKDFIGKDALLKQKERGVGRKLVHFKMIDKGI320 (392)
T ss_pred241CCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCCCCCCHHHHHHHHHCCCCEEEEEEEECCCCC320 (392)
T ss_dssp241ECHHHHHHHHHHHTCCCBTTTBCCCCCSSCSCCSSCTTTTTCGGGCCTTSCCTTHHHHHHHHHHCCCEEEEEEEESSSCC320 (392)
Q ss_pred321------CCC------------------CCCCEEEECCC--CC-------------CCCCHH--HHHHHHCCC392 (392)
Q d20180514_1321------LWA------------------NSGGTIAWEPA--RR-------------DFIGRI--ALEVQRKPG392 (392)
T 1V5V_A321PREGYKVYANGEMIGEVTSGTLSPLLNVGIGIAFVKEEYAKPGIEIEVEIRGQRKKAVTVTPPFYDPKKYGL392 (392)
T ss_pred321CCCCCEEEECCCCEEEEECCCCCCCCCCEEEEEEECHHHCCCCCEEEEEECCEEEEEEEEECCCCCCCCCCC392 (392)
T ss_dssp321CCTTCEEEETTEEEEEEEEEEECTTTCSEEEEEEEEGGGCSTTCEEEEEETTEEEEEEEECSCSSCTTTSST392 (392)


No 7
> 1WSV_A        Alignment in PIR format
MAC score = 161.78	Identity = 0.23

Download partial structureDownload full-length structure
Q ss_pred1CCCCHHHHHHCCCCCCCCCCCCCCCCC-CCHHHHHHHHHHCCCCCCCCCCCEEEEECCCHHHHHHHHHCCCCCCCCCCCC80 (369)
Q d20180514_11QTPLYEQHTSKGGRAVDDHGPMHEGHY-ASYIDEHHAERTDEMVMWKSHVTIVDLRMSDCREDLRYQLAWDVAKLTKSGK80 (369)
T 1WSV_A1RTPLYDFHLAHGGKMVAFAGWSLPVQYRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAEL-RPNQ80 (369)
T ss_pred1CCCCHHHHHHCCCEEEEECCEECCCCCCCHHHHHHHHHHHCCEEEECCCCEEEEEECCCHHHHHHHHCCCCCCCC-CCCE80 (369)
T ss_dssp1CCTTHHHHHHTTCCEEEETTEEEESCCSSCHHHHHHHHHHSEEEEECTTSEEEEEESTTHHHHHHTTBSSCCTTC-CTTE80 (369)
Q ss_pred81EEECEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHCCCCC---EE-EEECCCCHHHCCCCCCHHHHHHH160 (369)
Q d20180514_181ALYSICLNCSGGVEQDLLVYYFYDDFCRLVVNSATRTKDLSHITQHIELFL---IE-ITMRDELSMIIVQNPNATAGHNT160 (369)
T 1WSV_A81GTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQA160 (369)
T ss_pred81EEEEEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCEEEEEEECHHHHHHHHH160 (369)
T ss_dssp81EEEEEEECTTCCEEEEEEEEECTTSSEEEEECGGGHHHHHHHHHHHHHHHHTTTCCCEEEECCCEEEEEESTTHHHHHHT160 (369)
Q ss_pred161HCHHHHHHHHHCCCCEEEEE-CCCEEEEECCCCCCCCEEEEEECCCHHHHHHHHHHCC-CCCCCCCCCCCCCCCCCCCCC240 (369)
Q d20180514_1161CFNDALMQAVEGFLPFFSVQ-AGDLAIITTGYTPKAGYERAWPSVKANDFWRALVEAF-VKDCGLGARDTLGLTAMPNHF240 (369)
T 1WSV_A161GVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLY240 (369)
T ss_pred161HCCCCHHHCCCCEEEEEEECCCCCEEEECCCCCCCCEEEEEECHHHHHHHHHHHHHCCCCEEECHHHHHHHHHHHHHHHC240 (369)
T ss_dssp161TCSSCGGGSCTTBEEEEEETTEEEEEEESCCSSSSSEEEEEECHHHHHHHHHHHHTSTTEEECCHHHHHHHHHHTTCCCB240 (369)
Q ss_pred241CCCCCCCCCCCCC-----------------------------------------------------------CCC-----320 (369)
Q d20180514_1241GQATFETITPLWA-----------------------------------------------------------NSG-----320 (369)
T 1WSV_A241GNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPS320 (369)
T ss_pred241CCCCCCCCCHHHCCCHHHCCCCCCCCCCCCCHHHHHHHHHCCCCEEEEEEEEECCCCCCCCCEECCCCEEEEEEEECEEC320 (369)
T ss_dssp241TTTBCTTCCTTTTTCGGGSCHHHHHHTCSTTHHHHHHHHTTCCSEEEEEEEESSSCCCTTCEEECTTSCEEEEEEEEEEE320 (369)
Q ss_pred321------CEEEECC-C--CC-------------CCCCHH--HHHHHHCCC369 (369)
Q d20180514_1321------GTIAWEP-A--RR-------------DFIGRI--ALEVQRKPG369 (369)
T 1WSV_A321PSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTL369 (369)
T ss_pred321CCCCCEEEEEEECCHHCCCCCEEEEEECCEEEEEEEEECCCCCCCCCCC369 (369)
T ss_dssp321TTTTEEEEEEEEEGGGCSTTCEEEEECSSSEEEEEEECSCSSCCCCCCC369 (369)


No 8
> 2GAH_A        Alignment in PIR format
MAC score = 160.75	Identity = 0.16

Download partial structureDownload full-length structure
Q ss_pred1CCCCHHHHHHCCCCCCCCCCCCCCCCCC--------CHHHHHHHHHHCCCCCCCCCCCEEEEECCCHHHHHHHHHCCCCC80 (387)
Q d20180514_11QTPLYEQHTSKGGRAVDDHGPMHEGHYA--------SYIDEHHAERTDEMVMWKSHVTIVDLRMSDCREDLRYQLAWDVA80 (387)
T 2GAH_A1ITAMHSWHLSHGAEFEDVGQWKRPWYYPQAGETMDQAVYRESKAVRDSVGMLDATTLGKIEIRGKDAAEFLNRIYTNGYT80 (387)
T ss_pred1CCCCHHHHHHCCCEEEEECCEECCCCCCCCCCCHHHHHHHHHHHHHHCCEEEECCCCEEEEEECCCHHHHHHHHCCCCCC80 (387)
T ss_dssp1CCTTHHHHHHTTCEEEEETTEEEEEECCCTTCCHHHHHHHHHHHHHHSCEEEECTTSEEEEEESTTHHHHHHHHBSSCCT80 (387)
Q ss_pred81CCCCCCCEEECEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHCCC----CCEEE-EECCCCHHHCCCCC160 (387)
Q d20180514_181KLTKSGKALYSICLNCSGGVEQDLLVYYFYDDFCRLVVNSATRTKDLSHITQHIEL----FLIEI-TMRDELSMIIVQNP160 (387)
T 2GAH_A81KL-KVGMGRYGVMCKADGMIFDDGVTLRLAEDRFLLHTTTGGAADVLDWLEEWLQTEWPDLDVTCTSVTEQLATVAVVGP160 (387)
T ss_pred81CC-CCCEEEEEEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCEEEEEECCH160 (387)
T ss_dssp81TC-CTTBEEEEEEECTTCCEEEEEEEEEEETTEEEEEECTTTHHHHHHHHHHHHHHTCTTSCCEEEECTTTEEEEEEEST160 (387)
Q ss_pred161CHHHHHHHHCHHHH-HHHHH--CCCCEEEEE-CCCEEEEECCCCCCCCEEEEEECCCHHHHHHHHHHCC----CCCCCCC240 (387)
Q d20180514_1161NATAGHNTCFNDAL-MQAVE--GFLPFFSVQ-AGDLAIITTGYTPKAGYERAWPSVKANDFWRALVEAF----VKDCGLG240 (387)
T 2GAH_A161RSRDVIAKLASTVDVSNEGFKFMAFKDVVLDSGIEARISRISFSGELAFEIAVPAWHGLRVWEDVYAAGEEFNITPYGTE240 (387)
T ss_pred161HHHHHHHHHCCCCCCCHHHCCCCEEEEEEEECCCEEEEEEECCCCCCEEEEEECHHHHHHHHHHHHHCCHHCCCEEEEHH240 (387)
T ss_dssp161THHHHHHHHCTTSCCSTTTSCTTBEEEEECTTSCEEEEECCCSSSSCEEEEEEEGGGHHHHHHHHHHHTGGGTCEECCHH240 (387)
Q ss_pred241CCCCCCCCCCCCCCCCCCCCCCCC--------------------------------------------------------320 (387)
Q d20180514_1241ARDTLGLTAMPNHFGQATFETITP--------------------------------------------------------320 (387)
T 2GAH_A241TMHVLRAEKGFIIVGQDTDGTVTPQDAGMEWVVSKLKDFIGNRSYSRADNAREDRKQLVSVLPVDKSLRLPEGAALVASD320 (387)
T ss_pred241HHHHHHHHHHHHHCCCCCCCCCCHHHCCCHHHHCCCCCCCCHHHHHHHHHCCCCCEEEEEEEEECCCCCCCCCCEEECCC320 (387)
T ss_dssp241HHHHHHHHTTCCCTTTTCCSSCCTTTTTCGGGSCSSSCCTTGGGGGSGGGGCSCCEEEEEEEESSTTCCCCTTCEEEETT320 (387)
Q ss_pred321-----------------CCC-C---CCCEEEECC--C-C------------CCCCCHHHHHHHHCCC387 (387)
Q d20180514_1321-----------------LWA-N---SGGTIAWEP--A-R------------RDFIGRIALEVQRKPG387 (387)
T 2GAH_A321ALASEGITPMEGWVTSSYDSPNLGRTFGLALIKNGRNRIGEVLKTPVGDQLVDVVVSETVLYDPEGS387 (387)
T ss_pred321CCCCCCCCCEEEEEECCCCCCCCCCEEEEEEECHHHCCCCCEEEEEECCEEEEEEEECCCCCCCCCC387 (387)
T ss_dssp321CCCBTTBCCCCEEEEEEEEETTTTEEEEEEEEETGGGCTTCEEEEEETTEEEEEEEECSCCSSTTCT387 (387)


No 9
> 3GIR_A    Aminomethyltransferase; glycine cleavage system, aminotransferase, structural genomics; 1.60A {Bartonella henselae}     Alignment in PIR format
MAC score = 159.66	Identity = 0.26

Download partial structureDownload full-length structure
Q ss_pred1CCCCHHHHHHCCCCCCCCCCCCCCCCC-CCHHHHHHHHHHCCCCCCCCCCCEEEEECCCHHHHHHHHHCCCCCCCCCCCC80 (361)
Q d20180514_11QTPLYEQHTSKGGRAVDDHGPMHEGHY-ASYIDEHHAERTDEMVMWKSHVTIVDLRMSDCREDLRYQLAWDVAKLTKSGK80 (361)
T 3GIR_A1TLPLYELHEKAGAKFGAFAGWRMPLTYPLGVLKEHLHTRAHAGLFDISHMKLIAVEGPKAVEFLSYALPVDAALL-KIGQ80 (361)
T ss_pred1CCCCHHHHHHCCCEEEEECCEEECCCCCCCHHHHHHHHHCCCEEEECCCCEEEEEECCCHHHHHHHHCCCCCCCC-CCCC80 (361)
T ss_dssp1ECTTHHHHHHTTCEEEEETTEEEEEECTTCHHHHHHHHHHSEEEEECTTSEEEEEESTTHHHHHHHHSSSCTTTS-CTTB80 (361)
Q ss_pred81EEECEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHCCCCCEEEEECCCCHHHCCCCCCHHHHHHHHCHH160 (361)
Q d20180514_181ALYSICLNCSGGVEQDLLVYYFYDDFCRLVVNSATRTKDLSHITQHIELFLIEITMRDELSMIIVQNPNATAGHNTCFND160 (361)
T 3GIR_A81SRYSYLLNERAGILDDLILTRLAECRFMLVANAGNAQADFAELEKRAFGFECQVIAL-ERVLLALQGPQAAAVLADAG-L160 (361)
T ss_pred81EEEEEEECCCCCEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHCCCCCEEEEEC-CCEEEEEECCCHHHHHHHHC-C160 (361)
T ss_dssp81EEEEEEECTTCCEEEEEEEEEEETTEEEEEECGGGHHHHHHHHHHHTTTSSCEEEEC-CCEEEEEESTTHHHHHHHTT-C160 (361)
Q ss_pred161HHHHHHHCCCCEEEEECCCEEEEECCCCCCCCEEEEEECCCHHHHHHHHHHCC-CCCCCCCCCCCCCCCCCCCCCCCCCC240 (361)
Q d20180514_1161ALMQAVEGFLPFFSVQAGDLAIITTGYTPKAGYERAWPSVKANDFWRALVEAF-VKDCGLGARDTLGLTAMPNHFGQATF240 (361)
T 3GIR_A161PGNEL--LFMQG-FEPQQDWFITRSGYTGEDGFEIALPIGCARALAEKLLGDSRVEWVGLAARDSLRLEAGLCLHGNDIT240 (361)
T ss_pred161CHHHC--CCCEE-EECCCEEEEEECCCCCCCEEEEEEEHHHHHHHHHHHHHCCCCEECCHHHHHHHHHHCCCCCCCCCCC240 (361)
T ss_dssp161CCTTC--CTTBE-ECSSTTCEEESCCSSSSSEEEEEECHHHHHHHHHHHHTSTTEEECCHHHHHHHHHHTTCCCBTTTBC240 (361)
Q ss_pred241CCCCCCCC------------------------------------------------------------CC----------320 (361)
Q d20180514_1241ETITPLWA------------------------------------------------------------NS----------320 (361)
T 3GIR_A241PDTTPIDAALTWAVPKNVREKAQFYGAKAFLESLQKGPSRCRVGLKPQTRQPIRAGAVLFDNEGNRIGVVTSGGFGPSFD320 (361)
T ss_pred241CCCCHHHCCCCCEECCCCCCCCCCCCHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCEEECCCCEEECEEECCCCCCCCC320 (361)
T ss_dssp241TTCCTTTTTCGGGSCHHHHHHCCSTTHHHHHHHHHHCCSSEEEEEEESSSSCCCTTCEEECTTSCEEEEEEEEEEETTTT320 (361)
Q ss_pred321-CCEEEEC-CC---C-CCCCCHH-----HHHHHHCC----C361 (361)
Q d20180514_1321-GGTIAWE-PA---R-RDFIGRI-----ALEVQRKP----G361 (361)
T 3GIR_A321GPVAMGYVPVAWKVEGTEVFTELRGKKIALSVHSLPFVEQR361 (361)
T ss_pred321CEEEEEEECHHHCCCCCEEEEEECCEEEEEEEEECCCCCCC361 (361)
T ss_dssp321EEEEEEEECGGGCSTTCEEEEEETTEEEEEEEECSCSSCCC361 (361)


No 10
> 1VRQ_A        Alignment in PIR format
MAC score = 158.47	Identity = 0.15

Download partial structureDownload full-length structure
Q ss_pred1CCCCHHHHHHCCCCCCCCCCCCCCCCCC--------CHHHHHHHHHHCCCCCCCCCCCEEEEECCCHHHHHHHHHCCCCC80 (386)
Q d20180514_11QTPLYEQHTSKGGRAVDDHGPMHEGHYA--------SYIDEHHAERTDEMVMWKSHVTIVDLRMSDCREDLRYQLAWDVA80 (386)
T 1VRQ_A1LTAMHPWHLAHGAKFEDVGQWKRPWYYPQDGESMDEAVYRECKAVRDSVGMLDASTLGKIEIRGKDAAEFLNRMYTNGYT80 (386)
T ss_pred1CCCHHHHHHHCCCEEEEECCEECCCCCCCCCCCHHHHHHHHHHHHHHCCEEEECCCCEEEEEECCCHHHHHHHHCCCCCC80 (386)
T ss_dssp1CCTTHHHHHHTTCEEEEETTEEEEEECCCTTCCHHHHHHHHHHHHHHSCEEEECTTSEEEEEESTTHHHHHHHHBSSCCT80 (386)
Q ss_pred81CCCCCCCEEECEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHCCC----CCEEE-EECCCCHHHCCCCC160 (386)
Q d20180514_181KLTKSGKALYSICLNCSGGVEQDLLVYYFYDDFCRLVVNSATRTKDLSHITQHIEL----FLIEI-TMRDELSMIIVQNP160 (386)
T 1VRQ_A81KL-KVGMGRYGVMCKADGMIFDDGVTLRLAEDRFLMHTTTGGAADVLDWLEEWLQTEWPELDVTCTSVTEQLATVAVVGP160 (386)
T ss_pred81CC-CCCEEEEEEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCEEEEEECCH160 (386)
T ss_dssp81TC-CTTBEEEEEEECTTSCEEEEEEEEEEETTEEEEEECTTTHHHHHHHHHHHHHHTCTTSCCEEEECTTTEEEEEEEST160 (386)
Q ss_pred161CHHHHHHHHCHHH---HHHHHHCCCCEEEEEC-CCEEEEECCCCCCCCEEEEEECCCHHHHHHHHHHCCC----CCCCCC240 (386)
Q d20180514_1161NATAGHNTCFNDA---LMQAVEGFLPFFSVQA-GDLAIITTGYTPKAGYERAWPSVKANDFWRALVEAFV----KDCGLG240 (386)
T 1VRQ_A161RSRDVIAKLASSLDVSNDAFKFMAFQDVTLDSGIEARISRISFSGELAFEIAIPAWHGLQVWEDVYAAGQEFNITPYGTE240 (386)
T ss_pred161HHHHHHHHHCCCCCCCHHHCCCCEEEEEEEECCCEEEEEEECCCCCCEEEEEECHHHHHHHHHHHHHCCHHCCCEEEEHH240 (386)
T ss_dssp161THHHHHHHHSTTCCCSTTTSCTTBEEEEECTTSCEEEEECCCSSSSCEEEEEEEGGGHHHHHHHHHHHTGGGTCEECCHH240 (386)
Q ss_pred241CCCCCCCCCCCCCCCCCCCCCCCC--------------------------------------------------------320 (386)
Q d20180514_1241ARDTLGLTAMPNHFGQATFETITP--------------------------------------------------------320 (386)
T 1VRQ_A241TMHVLRAEKGFIIVGQDTDGTVTPQDAGMEWVVSKLKDFVGKRSFSREDNVREDRKHLVSVLPVDSSLRLAEGAALVAAD320 (386)
T ss_pred241HHHHHHHHHHHHHCCCCCCCCCCHHHCCCHHHHCCCCCCCCHHHHHHHHHCCCCCEEEEEEEEECCCCCCCCCCEEECCC320 (386)
T ss_dssp241HHHHHHHTTTCCCTTTTCCSSCCTTTTTCGGGSCSSSCCTTGGGGGSTGGGCTTCCEEEEEEESSTTCCCCTTCEEEETT320 (386)
Q ss_pred321----------------CCCC----CCCEEEECCC----C-CCCCC--------HHHHHH--HHCCC386 (386)
Q d20180514_1321----------------LWAN----SGGTIAWEPA----R-RDFIG--------RIALEV--QRKPG386 (386)
T 1VRQ_A321AVASEGVTPMEGWVTHAYNSPALGRTFGLALIKNGRNRIGEVLKTPVDGQLVDVQVSDLVLFDPEG386 (386)
T ss_pred321CCCCCCCCCEEEEEECCCCCCCCCCEEEEEEECHHHCCCCCEEEEEECCEEEEEEEECCCCCCCCC386 (386)
T ss_dssp321CCCBTTBCCCCEEEEEEEEETTTTEEEEEEEETTGGGCTTCEEEEEETTEEEEEEEECSCCSCTTC386 (386)