TreeThreader - Results

  Job information

Job ID: 26341
#Proteins: 1
Protein ID: 26341_1
Fasta ID: 26341_1
Submission time: 2015-09-24 16:31:38 +0800
Finished time: 2015-09-24 16:31:41 +0800
Identical Job(s): test hemoglobin_1 hemoglobin_4 26342_1 26343_1 26345_1 26348_1 39884_1

  Alignments

1
50
100
150
200
207
3GLA_A 3GLA_A 1GME_A 1GME_A 3L1E_A 3L1E_A 3AAB_A 3AAB_A 1RL1_A 1RL1_A 2WJ5_A 2WJ5_A 3Q9P_A 3Q9P_A 3IGF_A 3IGF_A 2XCM_C 2XCM_C 1WGV_A 1WGV_A

  Build multi-template model (choose up to 5 templates)

                   
Download full-length structure

  Top 10 hits

Query:
Job ID  : 26341_1
Length : 207
Sequence: MLRYLSRPLVHAARTTTAGAHAQPPLALRRLSSRSIGRSVAGRQGGGGSTGQVMPRGQSGPPLASLGRFFDDFGMDVFND PFFRPFLARGPGSSLEAADVSMGLDIAETDKEYVVKAELPGVKKEDIKVTFQEGILNIAAERKCEEVKEDERTQRHYSDF AYGKVSRSLRVPDAAEKDQVDAHLEDGVLTVKIAKGEHSKPKEIEVK

No Hit MAC Score Identity Cols Query HMM Template HMM
13GLA_A79.810.3310098-2061-100
21GME_A76.350.371451-2073-150
33L1E_A61.060.1999100-2071-105
43AAB_A59.620.2612133-2051-123
51RL1_A54.480.189892-2071-98
62WJ5_A52.630.169892-2071-100
73Q9P_A49.510.1884105-1971-85
83IGF_A44.310.161531-206214-374
92XCM_C43.840.159192-2071-91
101WGV_A38.660.1610857-2071-118

  Pairwise Query-Template Alignment

No 1
> 3GLA_A    Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A     Alignment in PIR format
MAC score = 79.81	Identity = 0.33

Download partial structureDownload full-length structure
Q ss_pred1CCCCCEECEEECCCEEEEEEECCCCCCCCEEEEEECCEEEEEEEEECEEEEECCCEEEEEEEEEEEEEEEEEECCCCCCC80 (109)
Q 26341_11ADVSMGLDIAETDKEYVVKAELPGVKKEDIKVTFQEGILNIAAERKCEEVKEDERTQRHYSDFAYGKVSRSLRVPDAAEK80 (109)
T 3GLA_A1AQWVPRVDIKEEVNHFVLYADLPGIDPSQIEVQMDKGILSIRGERKSESST--ETERFSRIERRYGSFHRRFALPDSADA80 (109)
T ss_pred1CCCCCCEEEEECCCEEEEEEECCCCCHHHEEEEEECCEEEEEEEECCCCCC--CCCEEEEEEECCCEEEEEEECCCCCCC80 (109)
T ss_dssp1CCSCCCEEEEECSSEEEEEEECTTSCGGGCEEEEETTEEEEEEEECCGGGS--SGGGEEEECCCCEEEEEEEECCTTBCT80 (109)
Q ss_pred81CCCEEEECCCEEEEEEECCCCCCCCEEEC109 (109)
Q 26341_181DQVDAHLEDGVLTVKIAKGEHSKPKEIEV109 (109)
T 3GLA_A81DGITAAGRNGVLEIRIPKRPA-------A109 (109)
T ss_pred81CCCEEEEECCEEEEEEECCCC-------C109 (109)
T ss_dssp81TSCEEEEETTEEEEEEEBCUU-------U109 (109)


No 2
> 1GME_A    Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A     Alignment in PIR format
MAC score = 76.35	Identity = 0.37

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCHHHHHHHCCCCCCCCCCHHHCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC80 (210)
Q 26341_11MLRYLSRPLVHAARTTTAGAHAQPPLALRRLSSRSIGRSVAGRQGGGGSTGQVMPRGQSGPPLASLGRFFDDFGMDVFND80 (210)
T 1GME_A1IV--RRSNVFDPFA---D-LWA-DPFDT-------------FR---------------------S---------------80 (210)
T ss_pred1EE--CCCCCCCCHH---H-HHC-CCCHH-------------HH---------------------H---------------80 (210)
T ss_dssp1CC--CSCCCBCTTC---G-GGS-SHHHH-------------HH---------------------H---------------80 (210)
Q ss_pred81CCCCCCCCCCCCCCCCCCCCCCEECEEECCCEEEEEEECCCCCCCCEEEEEECC-EEEEEEEEECEEEEECCCEEEEEEE160 (210)
Q 26341_181PFFRPFLARGPGSSLEAADVSMGLDIAETDKEYVVKAELPGVKKEDIKVTFQEG-ILNIAAERKCEEVKEDERTQRHYSD160 (210)
T 1GME_A81--IVP-AISGGGSE-TAAFANARMDWKETPEAHVFKADLPGVKKEEVKVEVEDGNVLVVSGERTKE--KEDKNDKWHRVE160 (210)
T ss_pred81--HCC-CCCCCCCC-CCCCCCCCEEEEECCCEEEEEEECCCCCHHHEEEEEECCCEEEEEEEECCC--CCCCCCCEEEEE160 (210)
T ss_dssp81--HGG-GTTSSCCS-HHHHGGGCEEEEECSSEEEEEEECTTCCGGGEEEEEETTTEEEEEECCCCC--CCCTTCEEEECC160 (210)
Q ss_pred161EEEEEEEEEEECCCCCCCCCCEEEECCCEEEEEEECCCCCCC--CEEECC210 (210)
Q 26341_1161FAYGKVSRSLRVPDAAEKDQVDAHLEDGVLTVKIAKGEHSKP--KEIEVK210 (210)
T 1GME_A161RSSGKFVRRFRLLEDAKVEEVKAGLENGVLTVTVPKAEVKKPEVKAIQIS210 (210)
T ss_pred161ECCCEEEEEEECCCCCCHHHEEEEEECCEEEEEEECCCCCCCCCEEEECC210 (210)
T ss_dssp161CCCCCEEEEEECSSCCCGGGCEEEEETTEEEEEEECCCCCTTCCCCCCCC210 (210)


No 3
> 3L1E_A    Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A     Alignment in PIR format
MAC score = 61.06	Identity = 0.19

Download partial structureDownload full-length structure
Q ss_pred1CCCEECEEECCCEEEEEEECCCCCCCCEEEEEECCEEEEEEEEECEEEEECCCEEEEEEEEEEEEEEEEEECCCCCCCCC80 (114)
Q 26341_11VSMGLDIAETDKEYVVKAELPGVKKEDIKVTFQEGILNIAAERKCEEVKEDERTQRHYSDFAYGKVSRSLRVPDAAEKDQ80 (114)
T 3L1E_A1GSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQEDFVEIHGKHNERQ--D-D-HGYI-SR----EFHRRYRLPSNVDQSA80 (114)
T ss_pred1CCCCEEEEECCCEEEEEEECCCCCHHHEEEEEECCEEEEEEEEECCC--C-C-CCEE-EE----EEEEEEECCCCCCHHH80 (114)
T ss_dssp1UCCSEEEEECSSEEEEEEECTTSCGGGEEEEEETTEEEEEEEEEEEE--T-T-TEEE-EE----EEEEEEECCTTBCTTS80 (114)
Q ss_pred81CEE-EECCCEEEEEEECCCCCC-----CCEEECC114 (114)
Q 26341_181VDA-HLEDGVLTVKIAKGEHSK-----PKEIEVK114 (114)
T 3L1E_A81LSCSLSADGMLTFSGPKIPSGVDAGHSERAIPVS114 (114)
T ss_pred81CEEEECCCCEEEEEEECCCCCCCCCCCCEEEEEC114 (114)
T ss_dssp81CEEEECTTSEEEEEEEBCCCCTTTTSSSCCCCCC114 (114)


No 4
> 3AAB_A    Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A 3vqk_A 3vql_A 3vqm_A     Alignment in PIR format
MAC score = 59.62	Identity = 0.26

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECEEECCCE80 (175)
Q 26341_11SRSIGRSVAGRQGGGGSTGQVMPRGQSGPPLASLGRFFDDFGMDVFNDPFFRPFLARGPGSSLEAADVSMGLDIAETDKE80 (175)
T 3AAB_A1MYYLGKEL-Q---KR---------SEELS-RGFY-----E--------------------------LVYPPVDMYEEGGY80 (175)
T ss_pred1CHHHHHHH-H---HH---------HHHHH-HHHC-----C--------------------------CCCCCEEEEECCCE80 (175)
T ss_dssp1UUUUUUUU-U---UU---------UUCCC-HHHH-----H--------------------------HHCSCEEEEEETTE80 (175)
Q ss_pred81EEEEEECCCCCCCCEEEEEEC-CEEEEEEEEECEEEEECCCEEEEEEEEEEEEEEEEEECCCCCCCC-CCEEEECCCEEE160 (175)
Q 26341_181YVVKAELPGVKKEDIKVTFQE-GILNIAAERKCEEVKEDERTQRHYSDFAYGKVSRSLRVPDAAEKD-QVDAHLEDGVLT160 (175)
T 3AAB_A81LVVVADLAGFNKEKIKARVSGQNELIIEAEREI-T-E--PG-VKYLT-QRPKYVRKVIRLPYNVAKDAEISGKYENGVLT160 (175)
T ss_pred81EEEEEECCCCCHHHEEEEECCCCEEEEEEEEEE-C-C--CC-CEEEE-EEEEEEEEEEECCCCCCCCCCEEEEEECCEEE160 (175)
T ss_dssp81EEEEEECCSCCGGGCEEEEETTTEEEEEEECCC-C-C--CS-CEEEE-CSCSEEEEEEECSSEECTTCCCEEEEETTEEE160 (175)
Q ss_pred161EEEECCCCCCCCEEE175 (175)
Q 26341_1161VKIAKGEHSKPKEIE175 (175)
T 3AAB_A161IRIPIAGTSV-FKFE175 (175)
T ss_pred161EEEECCCCCC-CCCC175 (175)
T ss_dssp161EEEEGGGEEC-SCCC175 (175)


No 5
> 1RL1_A    Suppressor of G2 allele of SKP1 homolog; beta sandwich, 7 beta strands, similar to P23, lacking LAST beta strand SEEN in P23, protein degradation; NMR {Homo sapiens} SCOP: b.15.1.3     Alignment in PIR format
MAC score = 54.48	Identity = 0.18

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCEECEEECCCEEEEEEECCCCCCCCEEEEEECCEEEEEEEEECEEEEECCCEEEEEEEEEEEEEEEEEEC80 (116)
Q 26341_11GSSLEAADVSMGLDIAETDKEYVVKAELPGVKKEDIKVTFQEGILNIAAERKCEEVKEDERTQRHYSDFAYGKVSRSLRV80 (116)
T 1RL1_A1GSHMT-HQSKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLP-----S---GE---------DYNLKLEL80 (116)
T ss_pred1CCCCC-CCCCCCEEEEECCCEEEEEEEECCCCHHHEEEEEECCEEEEEEECC-----C---CC---------EEEEEEEC80 (116)
T ss_dssp1UUUUU-UUCCCCEEEEECSSEEEEEECCCSCCGGGEEEECSSSCEEEEEECT-----T---SS---------EEEEEECB80 (116)
Q ss_pred81CCCCCCCCCEEEECCCEEEEEEECCCCCCCCEEECC116 (116)
Q 26341_181PDAAEKDQVDAHLEDGVLTVKIAKGEHSKPKEIEVK116 (116)
T 1RL1_A81LHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQ116 (116)
T ss_pred81CCCCCCCCCEEEEECCEEEEEEECCCCCCCCCCCCC116 (116)
T ss_dssp81SSCCCGGGEEEEECSSSEEEEEECSSCCCCSSSBTT116 (116)


No 6
> 2WJ5_A    Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus}     Alignment in PIR format
MAC score = 52.63	Identity = 0.16

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCEECEEECCCEEEEEEECCCCCCCCEEEEEECCEEEEEEEEECEEEEECCCEEEEEEEEEEEEEEEEEEC80 (118)
Q 26341_11GSSLEAADVSMGLDIAETDKEYVVKAELPGVKKEDIKVTFQEGILNIAAERKCEEVKEDERTQRHYSDFAYGKVSRSLRV80 (118)
T 2WJ5_A1GA---------MAQVPTDPGYFSVLLDVKHFSPEEISVKVVGDHVEVHARHEERP---DEHGFIA------REFHRRYRL80 (118)
T ss_pred1CC---------CCEEEECCCEEEEEEECCCCCHHHEEEEEECCEEEEEEEEEEEE---CCCCEEE------EEEEEEEEC80 (118)
T ss_dssp1CC---------CCCCCCCSSCEEEEEECTTSCGGGEEEEEETTEEEEEEEEEECS---STTCCEE------EEEEEEEEC80 (118)
Q ss_pred81CCCCCCCCCEEEE-CCCEEEEEEECCCCCC-CCEEECC118 (118)
Q 26341_181PDAAEKDQVDAHL-EDGVLTVKIAKGEHSK-PKEIEVK118 (118)
T 2WJ5_A81PPGVDPAAVTSALSPEGVLSIQATPASAQASLPSPPAA118 (118)
T ss_pred81CCCCCCCCEEEEECCCCEEEEEEECCCCCCCCEEEECC118 (118)
T ss_dssp81CTTBCTTCCEEEECTTSEEEEEECBCCCCCSSCCUUUU118 (118)


No 7
> 3Q9P_A    Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A     Alignment in PIR format
MAC score = 49.51	Identity = 0.18

Download partial structureDownload full-length structure
Q ss_pred1CEEECCCEEEEEEECCCCCCCCEEEEEECCEEEEEEEEECEEEEECCCEEEEEEEEEEEEEEEEEECCCCCCCCCCEEEE80 (94)
Q 26341_11DIAETDKEYVVKAELPGVKKEDIKVTFQEGILNIAAERKCEEVKEDERTQRHYSDFAYGKVSRSLRVPDAAEKDQVDAHL80 (94)
T 3Q9P_A1GGSHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHAARQD-------EHG--YISRCFTRKYTLPPGVDPTQVSSSL80 (94)
T ss_pred1CCCCCCCEEEEEEECCCCCHHHEEEEEECCEEEEEEEEECCCC-------CCC--EEEEEEEEEEECCCCCCHHHCEEEE80 (94)
T ss_dssp1UUCCCCCEEEEEEECTTTCCSEEEEEEETTEEEEEEEECUUUU-------UUU--CCCEEEEEEEECCTTCCGGGCEEEE80 (94)
Q ss_pred81-CCCEEEEEEECCC94 (94)
Q 26341_181-EDGVLTVKIAKGE94 (94)
T 3Q9P_A81SPEGTLTVEAPMPK94 (94)
T ss_pred81CCCCEEEEEEECCC94 (94)
T ss_dssp81CTTSEEEEEEECCC94 (94)


No 8
> 3IGF_A    ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP}     Alignment in PIR format
MAC score = 44.31	Identity = 0.16

Download partial structureDownload full-length structure
Q ss_pred1CCC----CCCCCHHHHHHHCC-CCC-CCCCCHHHCCCCCCCCCCCCCEECCCCCCCCCCCCC-CCCCCCCCCCCCCCCCC80 (214)
Q 26341_11MLR----YLSRPLVHAARTTT-AGA-HAQPPLALRRLSSRSIGRSVAGRQGGGGSTGQVMPR-GQSGPPLASLGRFFDDF80 (214)
T 3IGF_A1RVAAFLVTTADPLEVVSVRYLWGSAQQIGLTIGGVIQVSS----QTEGDLSAEFTPLSVTVVPDVTKGDWQPLIDALPN-80 (214)
T ss_pred1CEEEEEEECCCHHHHHHHHHHHHHHHHCCCCCCEEEEECH----HHHHHHHHHCCCCCEEEECCCCCCCCCCHHHHHHH-80 (214)
T ss_dssp1TEEEEEEECSCHHHHHHHHHHHHHHHHHTCCEEEEEECCC----SCCCCCGGGSTTSCEEECCCCBTTBCHHHHHHCCC-80 (214)
Q ss_pred81CCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECEEECCCEEEEEEECCCCCCCCEEEEEECCEEEEEEEEECEEEEECCCE160 (214)
Q 26341_181GMDVFNDPFFRPFLARGPGSSLEAADVSMGLDIAETDKEYVVKAELPGVKKEDIKVTFQEGILNIAAERKCEEVKEDERT160 (214)
T 3IGF_A81------------FV-------EQAEQAPKPITID--THNRQVRLFLPGFDKKQVKLTQYGPEVTVEA-------------160 (214)
T ss_pred81------------HH-------HHCCCCCCCCCCC--CCEEEEEEECCCCCHHHEEEEEECCEEEEEE-------------160 (214)
T ss_dssp81------------HH-------HHHHHSCCSEEEE--TTTTEEEEECTTCCGGGCEEEEETTEEEEEE-------------160 (214)
Q ss_pred161EEEEEEEEEEEEEEEEECCCCCC-CCCCEEEECCCEEEEEEECCCCCCCCEEEC214 (214)
Q 26341_1161QRHYSDFAYGKVSRSLRVPDAAE-KDQVDAHLEDGVLTVKIAKGEHSKPKEIEV214 (214)
T 3IGF_A161---------GDQRRNIFLPPALSGRPITGAKFQNNYLIISFLEHHHH-----HH214 (214)
T ss_pred161---------CCEEEEEECCHHHCCCCCEEEEEECCEEEEEECCCCCC-----CC214 (214)
T ss_dssp161---------TTEEEEEECCTTTTTCCEEEEEEETTEEEEEECCCUUU-----UU214 (214)


No 9
> 2XCM_C    SGT1-like protein, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} SCOP: b.15.1.0 PDB: 2jki_S*     Alignment in PIR format
MAC score = 43.84	Identity = 0.15

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCEECEEECCCEEEEEEECCCCCCCCEEEEEECCEEEEEEEEECEEEEECCCEEEEEEEEEEEEEEEEEEC80 (116)
Q 26341_11GSSLEAADVSMGLDIAETDKEYVVKAELPGVKKEDIKVTFQEGILNIAAERKCEEVKEDERTQRHYSDFAYGKVSRSLRV80 (116)
T 2XCM_C1A--------KYRHEYYQKPEEVVVTVFAKGIPKQNVNIDFGEQILSVVIEVP-----G--EDAYYLQ----PRLFGKI--80 (116)
T ss_pred1C--------CCCCCEEECCCEEEEEEEECCCCHHHCEEEEECCEEEEEEECC-----C--CCEEEEE----HHHCCCC--80 (116)
T ss_dssp1C--------CSEEEEEEETTEEEEEEECCSCCGGGEEEEECSSBEEEEECCT-----T--SCCEEEC----CBBSSCB--80 (116)
Q ss_pred81CCCCCCCCCEEEECCCEEEEEEECCCCCCCCEEECC116 (116)
Q 26341_181PDAAEKDQVDAHLEDGVLTVKIAKGEHSKPKEIEVK116 (116)
T 2XCM_C81----IPDKCKYEVLSTKIEICLAKADIITWASLEHG116 (116)
T ss_pred81----CCCCCEEEEECCEEEEEEECCCCCCCCCCCCC116 (116)
T ss_dssp81----CGGGCEEEECSSCEEEEEEBSSSCCCSCSBTT116 (116)


No 10
> 1WGV_A    KIAA1068 protein; CS domain, HSP20-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.15.1.4     Alignment in PIR format
MAC score = 38.66	Identity = 0.16

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECEEECCCEEEEEEECCC--CCCCCEEEEEECC80 (161)
Q 26341_11GQSGPPLASLGRFFDDFGMDVFNDPFFRPFLARGPGSSLEAADVSMGLDIAETDKEYVVKAELPG--VKKEDIKVTFQEG80 (161)
T 1WGV_A1GSS------------------------GSSGQKNPDS--YNGAVRENYTWSQDYTDLEVRVPVPKHVVKGKQVSVALSSS80 (161)
T ss_pred1CCC------------------------CCCCCCCCCC--CCCCCCCCEEEEECCCEEEEEEECCCCCCCCCEEEEEEECC80 (161)
T ss_dssp1CCC------------------------SSCSCSCSSS--SSSBCCSSCEEEEETTEEEEEEECCTTCCSGGGEEEEECSS80 (161)
Q ss_pred81EEEEEEEEECEEEEECCCEEEEEEEEEEEEEEEEEECCCCCCCCCCEEEEC-CCEEEEEEECCCCCC-------CCEEEC160 (161)
Q 26341_181ILNIAAERKCEEVKEDERTQRHYSDFAYGKVSRSLRVPDAAEKDQVDAHLE-DGVLTVKIAKGEHSK-------PKEIEV160 (161)
T 1WGV_A81SIRVAMLEE--------NGERV---------LMEGKLTHKINTESSLWSLEPGKCVLVNLSKVGEYWWNAILEGEEPIDI160 (161)
T ss_pred81EEEEEEECC--------CCCEE---------EECCCCCCCCCCCCCEEEEECCCEEEEEEEECCCCCCHHHHCCCCCCCH160 (161)
T ss_dssp81EEEEEEECS--------SSEEE---------EEEEEBSSCBCTTTCEEEECTTSEEEEEECBSSSCCCSCSBTTSCCCSC160 (161)
Q ss_pred161C161 (161)
Q 26341_1161K161 (161)
T 1WGV_A161D161 (161)
T ss_pred161H161 (161)
T ss_dssp161C161 (161)