TreeThreader - Results

  Job information

Job ID: d20200525
#Proteins: 4
Protein ID: d20200525_1
Fasta ID: seq1
Submission time: 2020-05-25 10:54:02 +0800
Finished time: 2020-05-27 00:09:23 +0800
Identical Job(s): NULL

  Alignments

1
50
100
150
200
250
279

  Build multi-template model (choose up to 5 templates)

Building multi-template model...

  Top 10 hits

Query:
Job ID  : d20200525_1
Length : 279
Sequence: PMFKKFEVIVEDENGIMEIVSALAPDRMSNTNPNSVCIHSTLSEAGSAHLTRAQCHTEPGHTPDSVIKQMTKDTGMGAYN LAAALYGLQEQVDMCWKIVLDVFKKQGKERIVTQEEARDTQPFKYRFTLMSGSVNLQMDGLINWRGGGGSMWQAPVSEAR GSECKKQFAAYHRVMHGYGLDYVREFIVHIRDMHHQIDWLFDRTNPDEEFRADACFNELRDEFEKEGYIKYRVCTRFADR VACGYGPVRNKLEHADPCAVDFRNILAPCSSGYDDNNVF

No Hit MAC Score Identity Cols Query HMM Template HMM

  Pairwise Query-Template Alignment