TreeThreader - Results

  Job information

Job ID: d20190830
#Proteins: 4
Protein ID: d20190830_3
Fasta ID: seq3
Submission time: 2019-08-30 10:55:16 +0800
Finished time: 2019-08-30 17:46:37 +0800
Identical Job(s): NULL

  Alignments

1
50
100
150
200
250
300
314

  Build multi-template model (choose up to 5 templates)

Building multi-template model...

  Top 10 hits

Query:
Job ID  : d20190830_3
Length : 314
Sequence: SLPVVSNASTLAPSTVAALGDSVLVRYVDGPFRNQLPKAVPEMPGLLVRYATTLRAEVLAAAPKLKVVLCAGLGLCNDGV DAACQRGVLVVNAPTSPWSEQFGVDVEQHHHQMFSVGHMSWKTVIHIFTILAWVRPKHHWYALIVTEGICYHWFIDNTNV EYSKWKYVMQYKMSARNDVPEVWNYDGQWCRRASMFFAISCLNGEAGHSRGPPETMYIHPSNYHECPLLKIIDLPMQAMA AGWAEGPKAIMNMQNMWIHSKNHYCDINLCVSNEDWFIPAASTAEAQDGRGTFVCESVRPHLAGEPFYLAVYIG

No Hit MAC Score Identity Cols Query HMM Template HMM

  Pairwise Query-Template Alignment