TreeThreader - Results

  Job information

Job ID: d20190812
#Proteins: 4
Protein ID: d20190812_3
Fasta ID: seq3
Submission time: 2019-08-12 10:54:06 +0800
Finished time: 2019-08-13 09:21:59 +0800
Identical Job(s): NULL

  Alignments

1
50
100
150
200
250
275

  Build multi-template model (choose up to 5 templates)

Building multi-template model...

  Top 10 hits

Query:
Job ID  : d20190812_3
Length : 275
Sequence: AASCSAGNKSARELIKQLWKTKFCCPIMVRLGMHDSYTWNKNIEEWFQRSGYNGSLRFYKELKHGAEAGLVNALNLVKPI KDWYSGWTYADLFTLASATAYCFAGGPKINKEWGRVDMGEPEKKYEPGRIKDAGTPSPAQHARDVFYRPGLNDKEIVTLS GAHTLGRQRDDMEGNGKPMTLYHKDMPGDPAGQSTTAQWLKQDNPYWWDIKESRKEDLIVLPYFAAYFEDFSFKHYPEKY AADLEASFKDYAQAHAKLSNLGAKIGGAEDFSLEG

No Hit MAC Score Identity Cols Query HMM Template HMM

  Pairwise Query-Template Alignment