TreeThreader - Results

  Job information

Job ID: REP102
#Proteins: 102
Protein ID: REP102_99
Fasta ID: 2300216
Submission time: 2019-08-05 16:54:58 +0800
Finished time: 2019-08-06 02:44:34 +0800
Identical Job(s): NULL

  Alignments

1
50
100
123

  Build multi-template model (choose up to 5 templates)

Building multi-template model...

  Top 10 hits

Query:
Job ID  : REP102_99
Length : 123
Sequence: ERLYKNTKTSGDANSTHEAERLFKNPMTSGHGNSTHEAERLFKNPMTSGHGNSTHEAERLFKNPMTSGHGNSTHEAERLF KNPMKTGNANSTQEAERLFKNPMKTGNANSTQEADRLFKNPMT

No Hit MAC Score Identity Cols Query HMM Template HMM

  Pairwise Query-Template Alignment