TreeThreader - Results

  Job information

Job ID: REP102
#Proteins: 102
Protein ID: REP102_95
Fasta ID: 36501597
Submission time: 2019-08-05 16:54:57 +0800
Finished time: 2019-08-06 02:44:17 +0800
Identical Job(s): NULL

  Alignments

1
50
100
150
200
250
300
350
400
450
485

  Build multi-template model (choose up to 5 templates)

Building multi-template model...

  Top 10 hits

Query:
Job ID  : REP102_95
Length : 485
Sequence: EMESDLKEIGRKDISSWDITPEMSDVAVEMETDLKETEKNDISPREKMPEISDVTVEMKTDLKETEKNDISTMEKIPEMI AVIAEMETDLKETGKNDISPREKIPEMSDVTAEMETDLEETEKYDISPREKMPEMSPIIADMETDLKETGKNGISPRETV PEMIDVTAEMETDLEETGKNDIFPREEIPEMSDVTVEMKTDLKEVGTNDIPPREKMPEMIDVTAEMGTDLKETKKNDISP REEIPEMSDVTVEMKTDLKEAGTNDIPPREKMAEMIDVTAEMGTDLKETGKNDISPREEIPEMSDVTVEMKTDLKEVGTN DIPPREKIPEMIDVTAEMGTDLKETRKNDISPREEIPEMSDVTVEMKTDLKEVGTNDIPPREKMPEMIDVTAEMGTDLKE TGKNDISPKEKIPEMIDVTAEMGTDLKETGKDNVSPREEIPEMIDISVELETDSRETGKNDIFAREKMPEMSDVTAEMET DLKET

No Hit MAC Score Identity Cols Query HMM Template HMM

  Pairwise Query-Template Alignment