TreeThreader - Results

  Job information

Job ID: DGDH
#Proteins: 96
Protein ID: DGDH_50
Fasta ID: UniRef100_V8NTF0
Submission time: 2019-08-04 18:22:53 +0800
Finished time: 2019-08-05 01:31:37 +0800
Identical Job(s): JIUOK_50

  Alignments

1
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
800
850
900
950
1000
1050
1100
1150
1200
1250
1300
1350
1400
1450
1500
1550
1561

  Build multi-template model (choose up to 5 templates)

Building multi-template model...

  Top 10 hits

Query:
Job ID  : DGDH_50
Length : 1561
Sequence: MNPPWSWDSSCKEHLNKKQSQKVILENIKEMEENEESNGDVLQHKENGDTSPVIEPDVPKVQASSKQFVDQDTQSDSKVS IFRRKEFTDQSDQTYTPPTYGTTSIDSFRKQSRNSQHFETQEKQFPGQESRRNSQQLSGQESRRGSQVLPGQESHRSSQH NQHLPCQESRRSSHGSQKSSRTQPINEVETKEHPSWVSPRTGKVMKCESQQTSRVWEFKPLADILQPFNQAVHKSRSIKK AATHISSQLVGQKAKISSQEPGSQASQQGTEQPKEVVSWISKKGKLVKCTSQQTSRIWEHKPLAEILSKQKTQSIRDTKE KAITGGTVLPKGPEKELAEIAKKQLISQESQKFQQGGQKIEGQESQKGSQELKGKESQDDRQVKDLIAAVGKAADITLQT DSSVSIFRRKELMDQNEQTGLSSGSSSSSRGSMQRFLQERPQQKSQFETQREGQESRRGSQDMKSKQSLHVRQESKVQES KHEKEESEGLGFVDDSKKTDAKVQKPSAVSGIVSDEKIVRVTGKRGAQLKCTSQQTSESLFKDYLIELYGSVPKQKKSQT PERNEFLTEGQESKVKAEVQQHIVQESKKSTQEPVLPGSRKASQQLEVRGSRKSLQESEVQGSRKASQQLEARESRKSIQ EPEIPGSRKVSQKLEPQESRKSLQEPEVPGSRKASQQLEPRESRKSLQEADVPGSRKASQQLEPRESRKSLQEAEVPGSR KASQQLEPRESRKSLQGAEVPGSRKASQQLEPRESRKSLQEAEVPGSKKASQQLEPRESRKILQEAEVSGSRKASQQLEP QESRKSLQEAEVPGSRKASQQLEAQESRKSIQEPEIPGFRKASQQLEPREKASQQLEPRESRKSLQEAEVPGSRKASQQL EAQESRKSLQEAKVPGSRKASQQLEPRESRKSLQEAEVPGSRKASQQLEPRESRKSLQEAEIPGSRKASQQLEPQKSRKS LQEAEVPGSRKASQQLEARESRKSLREPEVPGSRKASQQLEARESRKSLQEPEMPGSRKASQQLEAQESRKSLQEAEVPG SRKASQHLEAQESKKNIQEPEIPGLEKVSQQLEAQESQKSLQEPEVPGLEKVSQHLEAQESQKSIHEIEIPASRKVSPLL EAQDFKGNIQEPEVPGSRKTSLQQEAKESQKGVQEPEVPGLEKVSQQPEAQESYHSIQEAEVPGSRKVTQKESQQSRQLY LADLTEQVGASESQTTLHKFIGHLDRENKGLQTYSIISIEDGMWLNRKTGKVLVSHTQQTQVTSRWDPNKIAAEDGRMAM PLGPGSPIEGVGSQLEELNKTSTTDEEKTDQDQQQLLLKESPPSSQEVSGHDQPPLGKELESDIQQVSSQELLGDTENPQ NLEQTEREEHEYTDDVEQLLTQHLSEATLESIATAEGDDISIRTYSAVSLEEGCWVNKRTGRKVVSQNLQTEESTFRKCE NTEEPQNGDNPPEETEEPQNGDNLPEESSFQKHENKEEPQNGDNPPEESSFQKHENTEEPQNGDNPPEESSFQKRENTEE PQNGDNPPEEFSFQKHENTEEPQNDENPPEEGMTEITEPSG

No Hit MAC Score Identity Cols Query HMM Template HMM

  Pairwise Query-Template Alignment