TreeThreader - Results

  Job information

Job ID: repHLH
#Proteins: 28
Protein ID: repHLH_12
Fasta ID: 160236735_514735
Submission time: 2019-07-26 10:15:55 +0800
Finished time: 2019-07-26 12:26:23 +0800
Identical Job(s): NULL

  Alignments

1
50
100
150
200
222

  Build multi-template model (choose up to 5 templates)

Building multi-template model...

  Top 10 hits

Query:
Job ID  : repHLH_12
Length : 222
Sequence: KQNNSGEETSQMEGLEITLPDKQNNLNEEMSQMEDLETTLLNKKYNSNEEMSQMENLENILPNKQNNSSVEVSQIEGLET TLPNKQNNSNEEISQTEGLETTLPNKQNNSSEEISQMEGLEITVLSNQNNSNEEMSQMEGLEATLPDKQNNSSEETSQME GLETTLSNKQNNSNEEMSQMENLETTVPNKQNNSGIETSQMESLETTLPNKQNNSGEEISQM

No Hit MAC Score Identity Cols Query HMM Template HMM

  Pairwise Query-Template Alignment