TreeThreader - Results

  Job information

Job ID: d20190218
#Proteins: 4
Protein ID: d20190218_4
Fasta ID: seq4
Submission time: 2019-02-18 10:54:18 +0800
Finished time: 2019-02-19 13:09:21 +0800
Identical Job(s): NULL

  Alignments

1
50
100
150
200
250
300
350
400
450
479

  Build multi-template model (choose up to 5 templates)

Building multi-template model...

  Top 10 hits

Query:
Job ID  : d20190218_4
Length : 479
Sequence: AEKPWWKESDAIGSYPVSFMDSIGFGIIDLRGIVGVLDYLQELGIDVIWLSPVYESCNLDNPYDIDMYCQIMNEFGCMDD WRELLTRMHERNWKLLMDEKRNHTEDYHDWFIESRKSKDNRYRDPRIWIFGKAAKEPNHWGAAFSGSAWQYDFMTDEYYL HEFSKFQPDLSWDAHGVRVMVGECYKEWLEKGIDGFRMTVINMIINEMGLPESTTEQAGYVSGHPHFMNGPNIHKYLWER NEEVLSHWDQMTVGEMPWVCTHEDGLYHGEERKECHMTFQFEHKDHDSGYGGKYDVKPHSLLTLYMNLTFWQKALEHQGW NSLYLLNRDGPRVVSFFGEDGMQIIMSAKMLATVWHMMNGTRYIYQGEMIGTTNCRFESIDFYNDIETLNMYTEKVMETG EDIEKVMQWIYIKGCDNYRTPMGMDDQFHAEFTCNMPTITWNPNYKEINVKQEDQNKDYILGYYKMLIELRKNNKYVVY

No Hit MAC Score Identity Cols Query HMM Template HMM

  Pairwise Query-Template Alignment