TreeThreader - Results

  Job information

Job ID: d20190128
#Proteins: 4
Protein ID: d20190128_2
Fasta ID: seq2
Submission time: 2019-01-28 10:54:04 +0800
Finished time: 2019-02-18 02:05:23 +0800
Identical Job(s): NULL

  Alignments

1
50
100
150
169

  Build multi-template model (choose up to 5 templates)

Building multi-template model...

  Top 10 hits

Query:
Job ID  : d20190128_2
Length : 169
Sequence: RLMQLHIKLTNTIVPRSRKARVAHVLSRLIYFNEIMATLLTSDDAISFECEFLYGEMAAFPVIEQVLVLEKLMDPGQFPL CALGSGHQHLDQLCQVTKAHGLHAKQTGPKKGHGGFTLLKPVLERAKVEANKQAISGKGFDCWVTSIGAFTESMLSATSI EDSVRQALG

No Hit MAC Score Identity Cols Query HMM Template HMM

  Pairwise Query-Template Alignment