TreeThreader - Results

  Job information

Job ID: d20190114
#Proteins: 4
Protein ID: d20190114_1
Fasta ID: seq1
Submission time: 2019-01-14 10:54:03 +0800
Finished time: 2019-02-18 01:08:36 +0800
Identical Job(s): NULL

  Alignments

1
50
100
120

  Build multi-template model (choose up to 5 templates)

Building multi-template model...

  Top 10 hits

Query:
Job ID  : d20190114_1
Length : 120
Sequence: ERVVIVPKQCEGYLKVIKRKCTGTEMPMIGDRCFVHSTGNLLDGHKFDFSLRRCDKFSFQLGKGEYIKEYDFAIQTHHVG EVNHITCFIEYAYGSAMSTPKIPPNRTLVGEVELFEFGGE

No Hit MAC Score Identity Cols Query HMM Template HMM

  Pairwise Query-Template Alignment