TreeThreader - Results

  Job information

Job ID: d20190110
#Proteins: 4
Protein ID: d20190110_2
Fasta ID: seq2
Submission time: 2019-01-10 10:54:02 +0800
Finished time: 2019-02-18 01:01:30 +0800
Identical Job(s): NULL

  Alignments

1
50
100
150
196
3L01_B 3L01_B 2BIS_A 2BIS_A 2BFW_A 2BFW_A 3FRO_A 3FRO_A 3C4V_A 3C4V_A 3GUH_A 3GUH_A 1RZU_A 1RZU_A 3CX4_A 3CX4_A 3OKA_B 3OKA_B 3OKP_A 3OKP_A

  Build multi-template model (choose up to 5 templates)

                   
Download full-length structure

  Top 10 hits

Query:
Job ID  : d20190110_2
Length : 196
Sequence: GIDDSFWNESMLTGNRDDRKKSALMKFGMSVGVTFAFWGRFFRGQKFVHVLLKAIEILITKKEFQEMRFIITGKGDPKLE GGARDLEETGGNVYVIKEMLLREFSRFLVGSDKFVIKPSYQSPHGLVCLEYMCLGAIRIRSAMGGLRNIIKNETWILVKI YDPGELANVILMVLGLSRSDLSKWRTRCKKRAMSFS

No Hit MAC Score Identity Cols Query HMM Template HMM
13L01_B158.060.741961-196220-415
22BIS_A151.590.741961-196221-416
32BFW_A150.550.741961-1965-200
43FRO_A149.540.741961-196220-415
53C4V_A118.440.21941-196184-390
63GUH_A114.650.221891-196239-461
71RZU_A113.420.221891-196247-458
83CX4_A112.550.211891-196239-461
93OKA_B110.570.181911-196162-364
103OKP_A110.150.171911-196162-364

  Pairwise Query-Template Alignment

No 1
> 3L01_B        Alignment in PIR format
MAC score = 158.06	Identity = 0.74

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCEEEEEEEEECCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCC80 (196)
Q d20190110_21GIDDSFWNESMLTGNRDDRKKSALMKFGMSVGVTFAFWGRFFRGQKFVHVLLKAIEILITKKEFQEMRFIITGKGDPKLE80 (196)
T 3L01_B1GIDCSFWNESYLTGSRDERKKSLLSKFGMDEGVTFMFIGRFDRGQKGVDVLLKAIEILSSKKEFQEMRFIIIGKGDPELE80 (196)
T ss_pred1CEEHHHCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCEEEEEEECCCHHHH80 (196)
T ss_dssp1CCCTTTSSGGGCCSCHHHHHHHHHHTTTCCCCEEEEEECCBCSSSSCHHHHHHHHHHHTTSGGGGSEEEEEECCBCHHHH80 (196)
Q ss_pred81CHHHHHHHHCCCEEEEEHHHHHHHHHHHHCCCEEEECCCCCCCCHHHHHHHHHHCCEEEEECCCCCCHHHCCCCEEEECC160 (196)
Q d20190110_281GGARDLEETGGNVYVIKEMLLREFSRFLVGSDKFVIKPSYQSPHGLVCLEYMCLGAIRIRSAMGGLRNIIKNETWILVKI160 (196)
T 3L01_B81GWARSLEEKHGNVKVITEMLSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAIPIASAVGGLRDIITNETGILVKA160 (196)
T ss_pred81HHHHHHHHHCCCEEEEEEECCHHHHHHHHHHCCEEEECCCCCCCCHHHHHHHHCCCCEEEECCCCCCCEEECCCEEEECC160 (196)
T ss_dssp81HHHHHHHHHCTTEEEECSCCCHHHHHHHHTTCSEEEECCSCCSSCHHHHHHHHTTCEEEEESCTTHHHHCCTTSCEEECT160 (196)
Q ss_pred161CCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCC196 (196)
Q d20190110_2161YDPGELANVILMVLGLSRSDLSKWRTRCKKRAMSFS196 (196)
T 3L01_B161GDPGELANAILKALELSRSDLSKFRENCKKRAMSFS196 (196)
T ss_pred161CCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCC196 (196)
T ss_dssp161TCHHHHHHHHHHHHHHCSTTHHHHHHHHHHHHTTCC196 (196)


No 2
> 2BIS_A        Alignment in PIR format
MAC score = 151.59	Identity = 0.74

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCEEEEEEEEECCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCC80 (196)
Q d20190110_21GIDDSFWNESMLTGNRDDRKKSALMKFGMSVGVTFAFWGRFFRGQKFVHVLLKAIEILITKKEFQEMRFIITGKGDPKLE80 (196)
T 2BIS_A1GIDCSFWNESYLTGSRDERKKSLLSKFGMDEGVTFMFIGRFDRGQKGVDVLLKAIEILSSKKEFQEMRFIIIGKGDPELE80 (196)
T ss_pred1CCCCHHCCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHH80 (196)
T ss_dssp1CCCTTTSCGGGCCSCHHHHHHHHHHHTTCCSCEEEEEESCBCSSSSCHHHHHHHHHHHTTSGGGGGEEEEEECCBCHHHH80 (196)
Q ss_pred81CHHHHHHHHCCCEEEEEHHHHHHHHHHHHCCCEEEECCCCCCCCHHHHHHHHHHCCEEEEECCCCCCHHHCCCCEEEECC160 (196)
Q d20190110_281GGARDLEETGGNVYVIKEMLLREFSRFLVGSDKFVIKPSYQSPHGLVCLEYMCLGAIRIRSAMGGLRNIIKNETWILVKI160 (196)
T 2BIS_A81GWARSLEEKHGNVKVITEMLSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAIPIASAVGGLRDIITNETGILVKA160 (196)
T ss_pred81HHHHHHHHCCCCEEEEEECCCHHHHHHHHHCCCEEEECCCCCCCCHHHHHHHHCCCCEEECCCCCCCCEEECCCEEEECC160 (196)
T ss_dssp81HHHHHHHHTCTTEEEECSCCCHHHHHHHHTTCSEEEECCSCCSSCHHHHHHHTTTCEEEEESCTTHHHHCCTTTCEEECT160 (196)
Q ss_pred161CCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCC196 (196)
Q d20190110_2161YDPGELANVILMVLGLSRSDLSKWRTRCKKRAMSFS196 (196)
T 2BIS_A161GDPGELANAILKALELSRSDLSKFRENCKKRAMSFS196 (196)
T ss_pred161CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC196 (196)
T ss_dssp161TCHHHHHHHHHHHHTTTTSCTHHHHHHHHHHHHHSC196 (196)


No 3
> 2BFW_A    GLGA glycogen synthase; glycosyltransferase family 5 UDP/ADP-glucose-glycogen syntha rossman folds, transferase; 1.8A {Pyrococcus abyssi} SCOP: c.87.1.8     Alignment in PIR format
MAC score = 150.55	Identity = 0.74

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCEEEEEEEEECCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCC80 (196)
Q d20190110_21GIDDSFWNESMLTGNRDDRKKSALMKFGMSVGVTFAFWGRFFRGQKFVHVLLKAIEILITKKEFQEMRFIITGKGDPKLE80 (196)
T 2BFW_A1GIDCSFWNESYLTGSRDERKKSLLSKFGMDEGVTFMFIGRFDRGQKGVDVLLKAIEILSSKKEFQEMRFIIIGKGDPELE80 (196)
T ss_pred1CCCCCCCCHHHCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCHHHHHHHHHHHHHCCCCCCEEEEEECCCCHHHH80 (196)
T ss_dssp1CCCTTTSSGGGSCSCHHHHHHHHHHHTTCCSCEEEEEESCBCSSSSCHHHHHHHHHHHTTSGGGGGEEEEEECCBCHHHH80 (196)
Q ss_pred81CHHHHHHHHCCCEEEEEHHHHHHHHHHHHCCCEEEECCCCCCCCHHHHHHHHHHCCEEEEECCCCCCHHHCCCCEEEECC160 (196)
Q d20190110_281GGARDLEETGGNVYVIKEMLLREFSRFLVGSDKFVIKPSYQSPHGLVCLEYMCLGAIRIRSAMGGLRNIIKNETWILVKI160 (196)
T 2BFW_A81GWARSLEEKHGNVKVITEMLSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAIPIASAVGGLRDIITNETGILVKA160 (196)
T ss_pred81HHHHHHHHHCCCEEEEECCCCHHHHHHHHHHCCEEEECCCCCCCCHHHHHHHHCCCCEEECCCCCHHHHEECCCEEEECC160 (196)
T ss_dssp81HHHHHHHHHCTTEEEECSCCCHHHHHHHHTTCSEEEECCSCCSSCHHHHHHHHTTCEEEEESCHHHHHHCCTTTCEEECT160 (196)
Q ss_pred161CCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCC196 (196)
Q d20190110_2161YDPGELANVILMVLGLSRSDLSKWRTRCKKRAMSFS196 (196)
T 2BFW_A161GDPGELANAILKALELSRSDLSKFRENCKKRAMSFS196 (196)
T ss_pred161CCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCC196 (196)
T ss_dssp161TCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHTC196 (196)


No 4
> 3FRO_A    GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A*     Alignment in PIR format
MAC score = 149.54	Identity = 0.74

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCEEEEEEEEECCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCC80 (196)
Q d20190110_21GIDDSFWNESMLTGNRDDRKKSALMKFGMSVGVTFAFWGRFFRGQKFVHVLLKAIEILITKKEFQEMRFIITGKGDPKLE80 (196)
T 3FRO_A1GIDCSFWNESYLTGSRDERKKSLLSKFGMDEGVTFMFIGRFDRGQKGVDVLLKAIEILSSKKEFQEMRFIIIGKGDPELE80 (196)
T ss_pred1CCCCCCCCHHHCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCHHHHHHHHHHHHHCCCCCCEEEEEEECCCHHHH80 (196)
T ss_dssp1CCCTTTSCGGGSCSCHHHHHHHHHHHHTCCSCEEEEEECCSSCTTBCHHHHHHHHHHHHTSGGGGGEEEEEECCCCHHHH80 (196)
Q ss_pred81CHHHHHHHHCCCEEEEEHHHHHHHHHHHHCCCEEEECCCCCCCCHHHHHHHHHHCCEEEEECCCCCCHHHCCCCEEEECC160 (196)
Q d20190110_281GGARDLEETGGNVYVIKEMLLREFSRFLVGSDKFVIKPSYQSPHGLVCLEYMCLGAIRIRSAMGGLRNIIKNETWILVKI160 (196)
T 3FRO_A81GWARSLEEKHGNVKVITEMLSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAIPIASAVGGLRDIITNETGILVKA160 (196)
T ss_pred81HHHHHHHHHCCCEEEEECCCCHHHHHHHHHHCCEEEECCCCCCCCHHHHHHHHCCCCEEECCCCCCHHHCCCCCEEEECC160 (196)
T ss_dssp81HHHHHHHHHCTTEEEECSCCCHHHHHHHHTTCSEEEECBSCCSSCHHHHHHHHTTCEEEEESSTHHHHHCCTTTCEEECT160 (196)
Q ss_pred161CCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCC196 (196)
Q d20190110_2161YDPGELANVILMVLGLSRSDLSKWRTRCKKRAMSFS196 (196)
T 3FRO_A161GDPGELANAILKALELSRSDLSKFRENCKKRAMSFS196 (196)
T ss_pred161CCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCC196 (196)
T ss_dssp161TCHHHHHHHHHHHHHHTTTTTHHHHHHHHHHHHTSC196 (196)


No 5
> 3C4V_A        Alignment in PIR format
MAC score = 118.44	Identity = 0.2

Download partial structureDownload full-length structure
Q ss_pred1CCCCC-------CCCCCCCCCCCHHHHHHHHHHCCCCCCCEEEEEEEEECCCCHHHHHHHHHHHHHHCCCCCCEEEEEEC80 (209)
Q d20190110_21GIDDS-------FWNESMLTGNRDDRKKSALMKFGMSVGVTFAFWGRFFRGQKFVHVLLKAIEILITKKEFQEMRFIITG80 (209)
T 3C4V_A1DADPDRISVVSPGADVELYSPGNDRATERSRRELGIPLHTKVVAFVGRLQPFKGPQVLIKAVAALFDRDPDRNLRVIICG80 (209)
T ss_pred1CCCHHHEEEECCCCCHHHCCCCCCCCHHHHHHHCCCCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHCCCCEEEEEECC80 (209)
T ss_dssp1CCCGGGEEECCCCCCTTTSCCCSTTHHHHHHHHHTCCSSSEEEEEESCCCGGGCHHHHHHHHHHHHHHCTTCCEEEEEEC80 (209)
Q ss_pred81CCCC---CCCCHHHHHHHHCC--CEEEEEHHHHHHHHHHHHCCCEEEECCCCCCCCHHHHHHHHHHCCEEEEECCCCCCH160 (209)
Q d20190110_281KGDP---KLEGGARDLEETGG--NVYVIKEMLLREFSRFLVGSDKFVIKPSYQSPHGLVCLEYMCLGAIRIRSAMGGLRN160 (209)
T 3C4V_A81GPSGPNATPDTYRHMAEELGVEKRIRFLDPRPPSELVAVYRAADIVAVP-SFNESFGLVAMEAQASGTPVIAARVGGLPI160 (209)
T ss_pred81CCCCCHHHHHHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHCCEEEEC-CCCCCCCHHHHHHHHCCCCEEECCCCCCCH160 (209)
T ss_dssp81CCUUUUUUUUCHHHHHHHTTCGGGEEEECCCCHHHHHHHHHHCSEEEEC-CSSCSSCHHHHHHHHTTCCEEEESCTTHHH160 (209)
Q ss_pred161HHCC-CCEEEECCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCC209 (209)
Q d20190110_2161IIKN-ETWILVKIYDPGELANVILMVLGLSRSDLSKWRTRCKKRAMSFS209 (209)
T 3C4V_A161AVAEGETGLLVDGHSPHAWADALATLLDD-DETRIRMGEDAVEHARTFS209 (209)
T ss_pred161HHCCCCCEEEECCCCHHHHHHHHHHHHCC-HHHHHHHHHHHHHHHHHCC209 (209)
T ss_dssp161HSCBTTTEEEESSCCHHHHHHHHHHHHHC-HHHHHHHHHHHHHHHTTCC209 (209)


No 6
> 3GUH_A        Alignment in PIR format
MAC score = 114.65	Identity = 0.22

Download partial structureDownload full-length structure
Q ss_pred1C-CCC-------C------------CCCCCCCCCCCHHHHHHHHHHCCCCC--CCEEEEEEEEECCCCHHHHHHHHHHHH80 (230)
Q d20190110_21G-IDD-------S------------FWNESMLTGNRDDRKKSALMKFGMSV--GVTFAFWGRFFRGQKFVHVLLKAIEIL80 (230)
T 3GUH_A1GRLSGVLNGVDEKIWSPETDLLLASRYTRDTL-EDKAENKRQLQIAMGLKVDDKVPLFAVVSRLTSQKGLDLVLEALPGL80 (230)
T ss_pred1CCCEEEECCCCCCCCCCCCCCCCCCCCCCCCH-HHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCCCHHHHHHHHHHH80 (230)
T ss_dssp1TCEEECCCCCCTTTSCTTTCTTSSSCCCTTCG-GGGHHHHHHHHHHHTBCCCSSSCEEEEEEEESGGGTHHHHHHHHHHH80 (230)
Q ss_pred81HHCCCCCCEEEEEECCCCCCCCCHHHHHHHHCCCEEEEEHHHHHHHHHHHHCCCEEEECCCCCCCCHHHHHHHHHHCCEE160 (230)
Q d20190110_281ITKKEFQEMRFIITGKGDPKLEGGARDLEETGGNVYVIKEMLLREFSRFLVGSDKFVIKPSYQSPHGLVCLEYMCLGAIR160 (230)
T 3GUH_A81LE----QGGQLALLGAGDPVLQEGFLAAAAEYPGQVGVQIGYHEAFSHRIMGGADVILVPSRFEPCGLTQLYGLKYGTLP160 (230)
T ss_pred81HH----CCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCCHHHHHHHHCCCCE160 (230)
T ss_dssp81HH----TTCEEEEEEEECHHHHHHHHHHHHHSTBTEEEEESCCHHHHHHHHTTCSEEEECCSCCSCCSHHHHHHHTTCEE160 (230)
Q ss_pred161EEECCCCCCHHHC--------C--CCEEEECCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHC--CCCC230 (230)
Q d20190110_2161IRSAMGGLRNIIK--------N--ETWILVKIYDPGELANVILMVLGLSRSDLSKWRTRCKKRA--MSFS230 (230)
T 3GUH_A161LVRRTGGLADTVSDCSLENLADGVASGFVFEDSNAWSLLRAIRRAFVLWSR-PSLWR-FVQRQAMAMDFS230 (230)
T ss_pred161EEECCCCCCCCEECCCHHHCCCCCCCEEEECCCCHHHHHHHHHHHHHHHCC-HHHHH-HHHHHHHCCCCC230 (230)
T ss_dssp161EEESSHHHHHHCCBCCHHHHHTTCCCBEEECSSSHHHHHHHHHHHHHHHTS-HHHHH-HHHHHHTTCCCC230 (230)


No 7
> 1RZU_A    Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A     Alignment in PIR format
MAC score = 113.42	Identity = 0.22

Download partial structureDownload full-length structure
Q ss_pred1CCCCC------------CCCCCCCCCCCHHHHHHHHHHCCCCC-CCEEEEEEEEECCCCHHHHHHHHHHHHHHCCCCCCE80 (219)
Q d20190110_21GIDDS------------FWNESMLTGNRDDRKKSALMKFGMSV-GVTFAFWGRFFRGQKFVHVLLKAIEILITKKEFQEM80 (219)
T 1RZU_A1GIDADVWNPATDHLIHDNYSAANL-KNRALNKKAVAEHFRIDDDGSPLFCVISRLTWQKGIDLMAEAVDEIVSL----GG80 (219)
T ss_pred1CCCHHHCCCCCCHHHHHHCCHHHH-HHHHHHHHHHHHHCCCCCCCCCEEEEEEEEECCCCHHHHHHHHHHHHCC----CC80 (219)
T ss_dssp1CBCTTTSCTTTCTTSSSCCBTTBC-TTHHHHHHHHHHHHTCCCSSSCEEEEESCBSTTTTHHHHHTTHHHHHHT----TC80 (219)
Q ss_pred81EEEEECCCCCCCCCHHHHHHHHCCCEEEEEHHHHHHHHHHHHCCCEEEECCCCCCCCHHHHHHHHHHCCEEEEECCCCCC160 (219)
Q d20190110_281RFIITGKGDPKLEGGARDLEETGGNVYVIKEMLLREFSRFLVGSDKFVIKPSYQSPHGLVCLEYMCLGAIRIRSAMGGLR160 (219)
T 1RZU_A81RLVVLGAGDVALEGALLAAASRHHGRVGVAIGYNEPLSHLMQAGCDAIIIPSRFEPCGLTQLYALRYGCIPVVARTGGLA160 (219)
T ss_pred81EEEEECCCCHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHCCEEEECCCCCCCHHHHHHHHHCCCCCEECCCCCHH160 (219)
T ss_dssp81EEEEEECBCHHHHHHHHHHHHHTTTTEEEEESCCHHHHHHHHHHCSEEEECCSCCSSCSHHHHHHHHTCEEEEESSHHHH160 (219)
Q ss_pred161H---HHC-----C--CCEEEECCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCC219 (219)
Q d20190110_2161N---IIK-----N--ETWILVKIYDPGELANVILMVLGLSRSDLSKWRTRCKKRAMSFS219 (219)
T 1RZU_A161DTVIDANHAALASKAATGVQFSPVTLDGLKQAIRRTVRYYH-D-PKLWTQMQKLGMKSD219 (219)
T ss_pred161HHHHCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHHHHHHC-C-HHHHHHHHHHHHHHC219 (219)
T ss_dssp161HHCCBCCHHHHHTTCCCBEEESSCSHHHHHHHHHHHHHHHT-C-HHHHHHHHHHHHTCC219 (219)


No 8
> 3CX4_A        Alignment in PIR format
MAC score = 112.55	Identity = 0.21

Download partial structureDownload full-length structure
Q ss_pred1C-CC-------CC------------CCCCCCCCCCCHHHHHHHHHHCCCCC--CCEEEEEEEEECCCCHHHHHHHHHHHH80 (230)
Q d20190110_21G-ID-------DS------------FWNESMLTGNRDDRKKSALMKFGMSV--GVTFAFWGRFFRGQKFVHVLLKAIEIL80 (230)
T 3CX4_A1GRLSGVLNGVDEKIWSPETDLLLASRYTRDTL-EDKAENKRQLQIAMGLKVDDKVPLFAVVSRLTSQKGLDLVLEALPGL80 (230)
T ss_pred1CCCEEEECCCCCCCCCCCCCCCCCCCCCCCCH-HHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCCCHHHHHHHHHHH80 (230)
T ss_dssp1TCEEECCCCCCTTTSCTTTCTTSSSCCCTTCG-GGGHHHHHHHHHHHTBCCCSSSCEEEEECCBSGGGCHHHHHHHHHHH80 (230)
Q ss_pred81HHCCCCCCEEEEEECCCCCCCCCHHHHHHHHCCCEEEEEHHHHHHHHHHHHCCCEEEECCCCCCCCHHHHHHHHHHCCEE160 (230)
Q d20190110_281ITKKEFQEMRFIITGKGDPKLEGGARDLEETGGNVYVIKEMLLREFSRFLVGSDKFVIKPSYQSPHGLVCLEYMCLGAIR160 (230)
T 3CX4_A81LEQ----GGQLALLGAGDPVLQEGFLAAAAEYPGQVGVQIGYHEAFSHRIMGGADVILVPSRFAPCGLTQLYGLKYGTLP160 (230)
T ss_pred81HHC----CCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCCHHHHHHHHCCCCE160 (230)
T ss_dssp81HHH----TCEEEEEECBCHHHHHHHHHHHHHSTBTEEEEESCCHHHHHHHHHHCSEEEECCSCCSSCSHHHHHHHHTCEE160 (230)
Q ss_pred161EEECCCCCCHHHC--------C--CCEEEECCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHC--CCCC230 (230)
Q d20190110_2161IRSAMGGLRNIIK--------N--ETWILVKIYDPGELANVILMVLGLSRSDLSKWRTRCKKRA--MSFS230 (230)
T 3CX4_A161LVRRTGGLADTVSDCSLENLADGVASGFVFEDSNAWSLLRAIRRAFVLWSR-PSLWR-FVQRQAMAMDFS230 (230)
T ss_pred161EEECCCCCCCCEEECCHHHCCCCCCCEEEECCCCHHHHHHHHHHHHHHHCC-HHHHH-HHHHHHHCCCCC230 (230)
T ss_dssp161EEESSHHHHHHCCBCCHHHHHTTCCCBEEECSSSHHHHHHHHHHHHHHHTS-HHHHH-HHHHHHHHCCCC230 (230)


No 9
> 3OKA_B        Alignment in PIR format
MAC score = 110.57	Identity = 0.18

Download partial structureDownload full-length structure
Q ss_pred1CCCCC----CCCCCCCCCCCHHHHHHHHHHCCCCCCCEEEEEEEEECCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCC80 (208)
Q d20190110_21GIDDS----FWNESMLTGNRDDRKKSALMKFGMSVGVTFAFWGRFFRGQKFVHVLLKAIEILITKKEFQEMRFIITGKGD80 (208)
T 3OKA_B1HPTFEHLPSGVDVKRFTPATPEDKSATRKKLGFTDTTPVIACNSRLVPRKGQDSLIKAMPQVIAARP--DAQLLIVGSGR80 (208)
T ss_pred1CCCEEEECCCCCHHHCCCCCCCCHHHHHHHCCCCCCCEEEEEEECCCEECCHHHHHHHHHHHHHHCC--CEEEEEECCCC80 (208)
T ss_dssp1SSEEEECCCCBCTTTSCCCCHHHHHHHHHHHTCCTTCCEEEEESCSSGGGCHHHHHHHHHHHHHHCT--TCEEEEECCCT80 (208)
Q ss_pred81CCCCCHHHHH-HHHCCCEEEEEHHHHHHHHHHHHCCCEEEECCC------CCCCCHHHHHHHHHHCCEEEEECCCCCCHH160 (208)
Q d20190110_281PKLEGGARDL-EETGGNVYVIKEMLLREFSRFLVGSDKFVIKPS------YQSPHGLVCLEYMCLGAIRIRSAMGGLRNI160 (208)
T 3OKA_B81--YESTLRRLATDVSQNVKFLGRLEYQDMINTLAAADIFAMPARTRGGGLDVEGLGIVYLEAQACGVPVIAGTSGGAPET160 (208)
T ss_pred81--CHHHHHHHHHCCCCCEEEECCCCHHHHHHHHHHCCEEEECCCCCCCCCCCCCCCHHHHHHHHCCCCEEECCCCCCCCE160 (208)
T ss_dssp81--THHHHHHHTGGGGGGEEEEESCCHHHHHHHHHTCSEEEECCCCBGGGTBCCCSCHHHHHHHHTTCCEEEESSTTGGGG160 (208)
Q ss_pred161HCCCCEEEECCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHC-CCCC208 (208)
Q d20190110_2161IKNETWILVKIYDPGELANVILMVLGLSRSDLSKWRTRCKKRA-MSFS208 (208)
T 3OKA_B161VTPATGLVVEGSDVDKLSELLIELLDD-PIRRAAMGAAGRAHVEAEWS208 (208)
T ss_pred161ECCCCEEEECCCCHHHHHHHHHHHHCC-HHHHHHHHHHHHHHHHHHCC208 (208)
T ss_dssp161CCTTTEEEECTTCHHHHHHHHHHHHTC-HHHHHHHHHHHHHHHHHHTB208 (208)


No 10
> 3OKP_A    GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A*     Alignment in PIR format
MAC score = 110.15	Identity = 0.17

Download partial structureDownload full-length structure
Q ss_pred1CCCCC----CCCCCCCCCCCHHHHHHHHHHCCCCCCCEEEEEEEEECCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCC80 (208)
Q d20190110_21GIDDS----FWNESMLTGNRDDRKKSALMKFGMSVGVTFAFWGRFFRGQKFVHVLLKAIEILITKKEFQEMRFIITGKGD80 (208)
T 3OKP_A1HPTFEHLPSGVDVKRFTPATPEDKSATRKKLGFTDTTPVIACNSRLVPRKGQDSLIKAMPQVIAARP--DAQLLIVGSGR80 (208)
T ss_pred1CCCEEEECCCCCCCCCCCCCCHHHHHHHHHCCCCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHCC--CEEEEEEECCC80 (208)
T ss_dssp1SSEEEECCCCBCTTTSCCCCHHHHHHHHHHTTCCTTCCEEEEESCSCGGGCHHHHHHHHHHHHHHST--TCEEEEECCCT80 (208)
Q ss_pred81CCCCCHHHH-HHHHCCCEEEEEHHHHHHHHHHHHCCCEEEECCC------CCCCCHHHHHHHHHHCCEEEEECCCCCCHH160 (208)
Q d20190110_281PKLEGGARD-LEETGGNVYVIKEMLLREFSRFLVGSDKFVIKPS------YQSPHGLVCLEYMCLGAIRIRSAMGGLRNI160 (208)
T 3OKP_A81--YESTLRRLATDVSQNVKFLGRLEYQDMINTLAAADIFAMPARTRGGGLDVEGLGIVYLEAQACGVPVIAGTSGGAPET160 (208)
T ss_pred81--CHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHCCEEEECCCCCCCCCCCCCCCHHHHHHHHCCCCEEECCCCCCHHH160 (208)
T ss_dssp81--THHHHHHHTGGGGGGEEEEESCCHHHHHHHHHHCSEEEECCCCBGGGTBCCSSCHHHHHHHHTTCCEEECSSTTGGGG160 (208)
Q ss_pred161HCCCCEEEECCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHC-CCCC208 (208)
Q d20190110_2161IKNETWILVKIYDPGELANVILMVLGLSRSDLSKWRTRCKKRA-MSFS208 (208)
T 3OKP_A161VTPATGLVVEGSDVDKLSELLIELLDDP-IRRAAMGAAGRAHVEAEWS208 (208)
T ss_pred161HCCCCEEEECCCCHHHHHHHHHHHHCCH-HHHHHHHHHHHHHHHHHCC208 (208)
T ss_dssp161CCTTTEEECCTTCHHHHHHHHHHHHTCH-HHHHHHHHHHHHHHHHHTB208 (208)