TreeThreader - Results

  Job information

Job ID: d20181218
#Proteins: 4
Protein ID: d20181218_2
Fasta ID: seq2
Submission time: 2018-12-18 10:54:02 +0800
Finished time: 2019-02-17 23:34:47 +0800
Identical Job(s): NULL

  Alignments

1
50
100
150
200
241
3HB2_P 3HB2_P 1K7Q_A 1K7Q_A 3HBU_P 3HBU_P 1GO8_P 1GO8_P 1K7I_A 1K7I_A 1GO7_P 1GO7_P 1K7G_A 1K7G_A 1SAT_A 1SAT_A 1SMP_A 1SMP_A 1AF0_A 1AF0_A

  Build multi-template model (choose up to 5 templates)

                   
Download full-length structure

  Top 10 hits

Query:
Job ID  : d20181218_2
Length : 241
Sequence: ANTSFAYNSVHDMLRICWWHDKNTVQRKTSYSIDCDAFQITRNKYCANSTNVENKSLTGYFDFLQDVSSIPWGDTGNVKF CAENIEGAKLYCNFWSDVANETFTETTYNFKLQITFLNYTRDPSGNLDYGTQMYAYYPGNGQGAGYSWYNYHQSNIMNPG AEEYGRCEFTIDIGSALGDAHNHEYNAGEGDPSLNDKVSIELHYKFYIMSWQGENETGADMNGHRGGAMMHNDIAAIQRA Y

No Hit MAC Score Identity Cols Query HMM Template HMM
13HB2_P90.110.492411-2411-460
21K7Q_A88.550.492411-24118-477
33HBU_P88.330.492411-2411-460
41GO8_P87.190.472411-2411-460
51K7I_A86.130.512411-24118-477
61GO7_P85.620.52411-2411-460
71K7G_A80.780.492411-24118-477
81SAT_A70.310.232402-2411-464
91SMP_A65.020.232402-2411-464
101AF0_A58.690.242402-2411-470

  Pairwise Query-Template Alignment

No 1
> 3HB2_P        Alignment in PIR format
MAC score = 90.11	Identity = 0.49

Download partial structureDownload full-length structure
Q ss_pred1CCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCC80 (460)
Q d20181218_21ANTSFAYNSVHDMLRICWWHDKNTVQRKTSYSIDCDAFQITRNKYCANSTNVENKSLTGYFDFLQDVSSIPWGDTGNVKF80 (460)
T 3HB2_P1ANTSSAYNSVYDFLRYHDRGDGLTVNGKTSYSIDQAAAQITRENVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKF80 (460)
T ss_pred1CCCCCCCHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCEEEE80 (460)
T ss_dssp1CCCCHHHHHHHHHHTTTCCCTTCEETTEECCCHHHHHHHHTTTCEETTEETCCSCCEEEEEEECSCCSCCTTSCBCCBCC80 (460)
Q ss_pred81CHHHHHHHHHHHHHHHCCCCCEEEEECCCCCEEEEEEECCCCCCCCCCCCCCEEEECCCCCCCCCCCEEECCCC------160 (460)
Q d20181218_281CAENIEGAKLYCNFWSDVANETFTETTYNFKLQITFLNYTRDPSGNLDYGTQMYAYYPGNGQGAGYSWYNYHQS------160 (460)
T 3HB2_P81NAEQIEQAKLSLQSWSDVANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAGSSWYNYNQSNIRNPG160 (460)
T ss_pred81CHHHEEEEEEECCEEEEEECCEEEEECCCCCCCEEECCCCCCEEECCCCCCEEEECCCCCEEECCCCEEEEECCCCCCEE160 (460)
T ss_dssp81CHHHHHHHHHHHHHHHTTBSEEEEECCTTCCCSEEEEEECBCTTSCBCCSCCEEECCSSSSTTTTEEEEETTSHHHHCTT160 (460)
Q ss_pred161--------------------------------------------------------CCCCCCCCCCCC-EEEEEEHHHHH240 (460)
Q d20181218_2161--------------------------------------------------------NIMNPGAEEYGR-CEFTIDIGSAL240 (460)
T 3HB2_P161SEEYGRQTFTHAIGHALGLAHPGEYNAGEGDPSYNDAVYAEDSYQFSIISYWGENETGADYNGHYGGAPMIDDIAAIQRL240 (460)
T ss_pred161ECCCCCEEEECCCCCEEEECCCCCCCCCCCCCCEEEECCCCCEEEEECCCEEEECCCCCCEEEECCCCCEEEECCCCEEE240 (460)
T ss_dssp161TSHHHHHHHHHHHHHHHTCCCSSSCCTTSSCCCGGGCSSTTCSTTTCTTSSSCGGGGTCBCTTCCCCSCCHHHHHHHHHH240 (460)
Q ss_pred241CCCC-------------------------------------------------------------------------CCC320 (460)
Q d20181218_2241GDAH-------------------------------------------------------------------------NHE320 (460)
T 3HB2_P241YGANMTTRTGDSVYGFNSNTDRDFYTATDSSKALIFSVWDAGGTDTFDFSGYSNNQRINLNEGSFSDVGGLKGNVSIAHG320 (460)
T ss_pred241EECCCEEECCCCCEEEECCCCCEEEECCCCCEEEEEEEEECCCCCEEEEEECCCCCEEEECCCCCEEEECCCCCEEEECC320 (460)
T ss_dssp241HCBCTTTTCSCCEEETTCCSCCGGGBCCSTTCCCCEEECCCSSCCEEECTTCCSCCEEECSTTCEEBCTTCBSCEEECTT320 (460)
Q ss_pred321C-----CCCC------------------CC--------------------CCCCHHHHHHHCCEEEEECCC---------400 (460)
Q d20181218_2321Y-----NAGE------------------GD--------------------PSLNDKVSIELHYKFYIMSWQ---------400 (460)
T 3HB2_P321VTIENAIGGSGNDILVGNSADNILQGGAGNDVLYGGAGADTLYGGAGRDTFVYGSGQDSTVAAYDWIADFQKGIDKIDLS400 (460)
T ss_pred321CCCCEEECCCCCCEEECCCCCCEEECCCCCCEEECCCCCCEEECCCCCCEEEECCCCCEEECCCCEEEECCCCCCEEEEE400 (460)
T ss_dssp321CCCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCSGGGSBGGGCEEECSCCTTTCEEECG400 (460)
Q ss_pred401-CCCCC-CCCCC------------------------CCCC-----CCCHHHHHHHHHHHC460 (460)
Q d20181218_2401-GENET-GADMN------------------------GHRG-----GAMMHNDIAAIQRAY460 (460)
T 3HB2_P401AFRNEGQLSFVQDQFTGKGQEVMLQWDAANSITNLWLHEAGHSSVDFLVRIVGQAAQSDI460 (460)
T ss_pred401CCCCCEEECCCCEEEEECCCEEEEEECCCCCEEEEECCCCCCCCCEEEEECCCCCCCCEE460 (460)
T ss_dssp401GGGGGSCCEECSSCCCSSSCEEEEEEETTTTEEEEEEECTTCSSCCEEEEEESCCCGGGE460 (460)


No 2
> 1K7Q_A        Alignment in PIR format
MAC score = 88.55	Identity = 0.49

Download partial structureDownload full-length structure
Q ss_pred1CCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCC80 (460)
Q d20181218_21ANTSFAYNSVHDMLRICWWHDKNTVQRKTSYSIDCDAFQITRNKYCANSTNVENKSLTGYFDFLQDVSSIPWGDTGNVKF80 (460)
T 1K7Q_A1ANTSSAYNSVYDFLRYHDRGDGLTVNGKTSYSIDQAAAQITRENVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKF80 (460)
T ss_pred1CCCCCCCCCHHHHHHCCCCCCCCEEEEEEEEECCCCCCCEEECCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCCEEEE80 (460)
T ss_dssp1CCCCHHHHHHHHHHTTTCCCTTCEETTEECCCHHHHHHHHTTTCEETTEESCCSCCEEEEEEECSCCSCCTTSCBCCBCC80 (460)
Q ss_pred81CHHHHHHHHHHHHHHHCCCCCEEEEECCCCCEEEEEEECCCCCCCCCCCCCCEEEECCCCCCCCCCCEEECCCCCCC---160 (460)
Q d20181218_281CAENIEGAKLYCNFWSDVANETFTETTYNFKLQITFLNYTRDPSGNLDYGTQMYAYYPGNGQGAGYSWYNYHQSNIM---160 (460)
T 1K7Q_A81NAEQIEQAKLSLQSWSDVANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAGSSWYNYNQSNIRNPG160 (460)
T ss_pred81CCCCEEEEEECCCCEEEEECCEEEEEECCCCCCEEECCCCCCEEECCCCCCEEEEECCCCEEECCCCEEEEECCCCCCEE160 (460)
T ss_dssp81CHHHHHHHHHHHHHHHTTBSEEEEECCTTCCCSEEEEEECBCTTSCBCCSCCEEECCSSSSTTTTEEEEETTSHHHHCTT160 (460)
Q ss_pred161-----------------------------------------------------------CCCCCCCCC-EEEEEEHHHHH240 (460)
Q d20181218_2161-----------------------------------------------------------NPGAEEYGR-CEFTIDIGSAL240 (460)
T 1K7Q_A161SEEYGRQTFTHAIGHALGLAHPGEYNAGEGDPSYNDAVYAEDSYQFSIMSYWGENETGADYNGHYGGAPMIDDIAAIQRL240 (460)
T ss_pred161ECCCCCCEEEECCCCEEEECCCCCCCCCCCCCCEEEECCCCCEEEECCCCEEEECCCCCCEEEECCCCCEEEECCCCEEE240 (460)
T ss_dssp161TSHHHHHHHHHHHHHHHTCCCSSSCCTTSSCCCGGGCSSTTCSTTTCTTCSSCGGGGTCBCTTCCCCSCCHHHHHHHHHH240 (460)
Q ss_pred241CCCC-------------------------------------------------------------------------CCC320 (460)
Q d20181218_2241GDAH-------------------------------------------------------------------------NHE320 (460)
T 1K7Q_A241YGANMTTRTGDSVYGFNSNTDRDFYTATDSSKALIFSVWDAGGTDTFDFSGYSNNQRINLNEGSFSDVGGLKGNVSIAHG320 (460)
T ss_pred241ECCCCEEECCCCEEEECCCCCEEEEECCCCCEEEEEEEEEECCCCEEEEECCCCCEEEEECCCCCCEECCCCCCEEEECC320 (460)
T ss_dssp241HCBCTTTTCSCCEEETTCCSCCGGGBCSSTTCCCCEEECCCSSCCEEECTTCCSCCEEECSTTCEEBCTTCBSCEEECTT320 (460)
Q ss_pred321C-----------------------CCCCCC------------------C--CCCHHHHHHHCCEEEEECC----------400 (460)
Q d20181218_2321Y-----------------------NAGEGD------------------P--SLNDKVSIELHYKFYIMSW----------400 (460)
T 1K7Q_A321VTIENAIGGSGNDILVGNSADNILQGGAGNDVLYGGAGADTLYGGAGRDTFVYGSGQDSTVAAYDWIADFQKGIDKIDLS400 (460)
T ss_pred321CCCCEEECCCCCCEEECCCCCCEEECCCCCCEEECCCCCCEEECCCCCCEEEECCCCCEEECCCCEEEECCCCCCEEEEE400 (460)
T ss_dssp321CCCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCSGGGSBGGGCEEESSCCTTTCEEECG400 (460)
Q ss_pred401CCCCC-CCCCCCC------------------------CCC-----CCCHHHHHHHHHHHC460 (460)
Q d20181218_2401QGENE-TGADMNG------------------------HRG-----GAMMHNDIAAIQRAY460 (460)
T 1K7Q_A401AFRNEGQLSFVQDQFTGKGQEVMLQWDAANSITNLWLHEAGHSSVDFLVRIVGQAAQSDI460 (460)
T ss_pred401CCCCCEEECCCCEEEEECCCEEEEEECCCCCEEEEECCCCCCCCCEEEEECCCCCEEEEE460 (460)
T ss_dssp401GGGGGCCCEEESSCCCSSSCEEEEEEETTTTEEEEEEECTTCSSCCEEEEEESCCCGGGE460 (460)


No 3
> 3HBU_P        Alignment in PIR format
MAC score = 88.33	Identity = 0.49

Download partial structureDownload full-length structure
Q ss_pred1CCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCC80 (460)
Q d20181218_21ANTSFAYNSVHDMLRICWWHDKNTVQRKTSYSIDCDAFQITRNKYCANSTNVENKSLTGYFDFLQDVSSIPWGDTGNVKF80 (460)
T 3HBU_P1ANTSSAYNSVYDFLRYHDRGDGLTVNGKTSYSIDQAAAQITRENVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKF80 (460)
T ss_pred1CCCCCCCCCHHHHEEHHCCCCCCEEEEEECCCCCCCCCEEEECCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCCCEEE80 (460)
T ss_dssp1CCCCHHHHHHHHHHTTTCCCTTCEETTEECCCHHHHHHHHTTTCEETTEESCCSCCEEEEEEECSCCSCCTTSCBCCBCC80 (460)
Q ss_pred81CHHHHHHHHHHHHHHHCCCCCEEEEECCCCCEEEEEEECCCCCCCCCCCCCCEEEECCCCCCCCCCCEEECCCCCCC---160 (460)
Q d20181218_281CAENIEGAKLYCNFWSDVANETFTETTYNFKLQITFLNYTRDPSGNLDYGTQMYAYYPGNGQGAGYSWYNYHQSNIM---160 (460)
T 3HBU_P81NAEQIEQAKLSLQSWSDVANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAGSSWYNYNQSNIRNPG160 (460)
T ss_pred81CCCCCEEEEEECCCEEEEECCCCEEEECCCCCCEEECCCCCCEEECCCCCCEEEEECCCCEEECCCCEEEEECCCCCCEE160 (460)
T ss_dssp81CHHHHHHHHHHHHHHHTTBSEEEEECCTTCCCSEEEEEECBCTTSCBCCSCCEEEECSSSSTTTTEEEEETTSHHHHCTT160 (460)
Q ss_pred161-----------------------------------------------------------CCC-CCCCCCEEEEEEHHHHH240 (460)
Q d20181218_2161-----------------------------------------------------------NPG-AEEYGRCEFTIDIGSAL240 (460)
T 3HBU_P161SEEYGRQTFTHEIGHALGLAHPGEYNAGEGDPSYNDAVYAEDSYQFSIHSYWGENETGADYNGHYGGAPMIDDIAAIQRL240 (460)
T ss_pred161ECCCCCEEEEECCCEEEEECCCCCCCCCCCCCCCEEECCCCEEEEECCCCEEEECCCCCEEEEECCCCCEEECCCCCEEE240 (460)
T ss_dssp161TSHHHHHHHHHHHHHHHTCCCSSSCCTTSSCCCGGGCSBTTCSTTTCTTCSSCGGGGTCBCTTCCCCSCCHHHHHHHHHH240 (460)
Q ss_pred241CCCC-------------------------------------------------------------------------CCC320 (460)
Q d20181218_2241GDAH-------------------------------------------------------------------------NHE320 (460)
T 3HBU_P241YGANMTTRTGDSVYGFNSNTDRDFYTATDSSKALIFSVWDAGGTDTFDFSGYSNNQRINLNEGSFSDVGGLKGNVSIAHG320 (460)
T ss_pred241ECCCCEEECCCCEEEEECCCCCEEEEECCCCCEEEEEEECCCCCCEEEEECCCCCEEEEECCCCCEEECCCCCCEEEECC320 (460)
T ss_dssp241HCBCTTTTCSCCEEETTCCSCCGGGBCSSTTCCCCEEECCCSSCCEEECTTCCSCCEEECSTTCEEBCTTCBSCEEECTT320 (460)
Q ss_pred321C-----CCCC---------CC--CC--------C-------------------CHHHHHHHCCEEEEECCC---------400 (460)
Q d20181218_2321Y-----NAGE---------GD--PS--------L-------------------NDKVSIELHYKFYIMSWQ---------400 (460)
T 3HBU_P321VTIENAIGGSGNDILVGNSADNILQGGAGNDVLYGGAGADTLYGGAGRDTFVYGSGQDSTVAAYDWIADFQKGIDKIDLS400 (460)
T ss_pred321CCCCEEECCCCCCEEECCCCCCEEECCCCCCEEECCCCCCEEECCCCCCEEEECCCCCEEECCCCEEECCCCCCCEEEEC400 (460)
T ss_dssp321CCCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCSGGGSBGGGCEEECSCCTTTCEEECG400 (460)
Q ss_pred401-CCCC-CCCCCCC-----------CCC------------------CCCHHHHHHHHHHHC460 (460)
Q d20181218_2401-GENE-TGADMNG-----------HRG------------------GAMMHNDIAAIQRAY460 (460)
T 3HBU_P401AFRNEGQLSFVQDQFTGKGQEVMLQWDAANSITNLWLHEAGHSSVDFLVRIVGQAAQSDI460 (460)
T ss_pred401CCCCCEECCCCCEEEEECCCCEEEEECCCCCEEEEECCCCCCCCCEEEEEEECCCCCEEE460 (460)
T ss_dssp401GGGGGCCCEEESSCCCSSSSEEEEEEETTTTEEEEEEECTTCSSCCEEEEEESCCCGGGE460 (460)


No 4
> 1GO8_P        Alignment in PIR format
MAC score = 87.19	Identity = 0.47

Download partial structureDownload full-length structure
Q ss_pred1CCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCC80 (460)
Q d20181218_21ANTSFAYNSVHDMLRICWWHDKNTVQRKTSYSIDCDAFQITRNKYCANSTNVENKSLTGYFDFLQDVSSIPWGDTGNVKF80 (460)
T 1GO8_P1ANTSSAYNSVYDFLRYHDRGDGLTVNGKTSYSIDQAAAQITRENVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKF80 (460)
T ss_pred1CCCCCCCCCHHHHHHHHCCCCCCEECCCCCCCCCCCCCCCEECCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCEEC80 (460)
T ss_dssp1UUCCHHHHHHHHHTTTTCCCTTCEETTEECCCHHHHHHHHTTTCEETTEETCCSCCEEEEEEECSCCSCCTTSCBCCBCC80 (460)
Q ss_pred81CHHHHHHHHHHHHHHHCCCCCEEEEECCCCCEEEEEEECCCCCCCCCCCCCCEEEECCCCCCCCCCCEEECCCCC-----160 (460)
Q d20181218_281CAENIEGAKLYCNFWSDVANETFTETTYNFKLQITFLNYTRDPSGNLDYGTQMYAYYPGNGQGAGYSWYNYHQSN-----160 (460)
T 1GO8_P81NAEQIEQAKLSLQSWSDVANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAGSSWYNYNQSNIRNPG160 (460)
T ss_pred81CCCCEEEEEECCCCEEEEECCEEEEEECCCCCCEEECCCCCCEEECCCCCCEEEECCCCCEEECCCCEEEEECCCCCCEE160 (460)
T ss_dssp81CHHHHHHHHHHHHHHHTTBSEEEEECCTTCCCSEEEEEECBCTTSCBCCSCCEEECCSSSSTTTTEEEEETTSHHHHCTT160 (460)
Q ss_pred161---------------------------------------------------------------C----------------240 (460)
Q d20181218_2161---------------------------------------------------------------I----------------240 (460)
T 1GO8_P161SEEYGRQTFTHEIGHALGLAHPGEYNAGEGDPSYNDAVYAEDSYQFSILSYWGENETGADYNGHYGGAPMIDDIAAIQRL240 (460)
T ss_pred161ECCCCCEEEEECCCCCEEECCCCCCEEEECCCCEEEEEECCCEEEEEEEEEEEECCCCCEEEECCCCCCEEECCCCCCEE240 (460)
T ss_dssp161TSHHHHHHHHHHHHHHHTCCCSSSCCTTSSCCCGGGCSSTTCSTTTCTTCSSCGGGGTCBCTTCCCCSCCHHHHHHHHHH240 (460)
Q ss_pred241--C----------------------CCC-CCCCC-----------------------------CEEEEEEHHHHHCCCC-320 (460)
Q d20181218_2241--M----------------------NPG-AEEYG-----------------------------RCEFTIDIGSALGDAH-320 (460)
T 1GO8_P241YGANMTTRTGDSVYGFNSNTDRDFYTATDSSKALIFSVWDAGGTDTFDFSGYSNNQRINLNEGSFSDVGGLKGNVSIAHG320 (460)
T ss_pred241EEEEEEEECCCCCEEEECCCCEEEEECCCCCEEEEEEEEEECCCCCEEEEECCCCCEEEECCCCCEEEECCCCCEEEECC320 (460)
T ss_dssp241HCBCTTTTCSCCEEETTCCSCCGGGBCCSTTCCCCEEECCCSSCCEEECTTCCSCCEEECSTTCEEBCTTCBSCEEECTT320 (460)
Q ss_pred321-------CCCCC----CCCCC---------------------------CC--CCHHHHHHHCCEEEEECC---------C400 (460)
Q d20181218_2321-------NHEYN----AGEGD---------------------------PS--LNDKVSIELHYKFYIMSW---------Q400 (460)
T 1GO8_P321VTIENAIGGSGNDILVGNSADNILQGGAGNDVLYGGAGADTLYGGAGRDTFVYGSGQDSTVAAYDWIADFQKGIDKIDLS400 (460)
T ss_pred321CCCCEEECCCCCCEEECCCCCCEEECCCCCCEEECCCCCCEEECCCCCCEEEECCCCCEEECCCCEEEECCCCCCEEEEE400 (460)
T ss_dssp321CCCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCSGGGSBGGGCEEECSCCTTTCEEECG400 (460)
Q ss_pred401CCCCCC--CCCCC------------------------CCC-----CCCHHHHHHHHHHHC460 (460)
Q d20181218_2401GENETG--ADMNG------------------------HRG-----GAMMHNDIAAIQRAY460 (460)
T 1GO8_P401AFRNEGQLSFVQDQFTGKGQEVMLQWDAANSITNLWLHEAGHSSVDFLVRIVGQAAQSDI460 (460)
T ss_pred401CCCCCEECCCCCEEEEECCCEEEEEECCCCCEEEEECCCCCCCCCCEEEECCCCCCCCEE460 (460)
T ss_dssp401GGGGGSCCEECSSCCCSSSCEEEEEEETTTTEEEEEEECTTCSSCCEEEEEESCCCGGGE460 (460)


No 5
> 1K7I_A    PROC, secreted protease C; metalloprotease, hydrolase; 1.59A {Erwinia chrysanthemi} SCOP: b.80.7.1 d.92.1.6 PDB: 1k7g_A 1k7q_A 1go8_P 3hbv_P 3hda_P 3hbu_P 1go7_P 3hb2_P     Alignment in PIR format
MAC score = 86.13	Identity = 0.51

Download partial structureDownload full-length structure
Q ss_pred1CCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCC80 (460)
Q d20181218_21ANTSFAYNSVHDMLRICWWHDKNTVQRKTSYSIDCDAFQITRNKYCANSTNVENKSLTGYFDFLQDVSSIPWGDTGNVKF80 (460)
T 1K7I_A1ANTSSAYNSVYDFLRYHDRGDGLTVNGKTSYSIDQAAAQITRENVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKF80 (460)
T ss_pred1CCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCCCCC80 (460)
T ss_dssp1CCCCHHHHHHHHHTTTTCCSTTCEETTEECCCHHHHHHHHTTTCEETTEESCCSCCEEEEEEECSCCSCCTTSCBCCBCC80 (460)
Q ss_pred81CHHHHHHHHHHHHHHHCCCCCEEEEECCCCCEEEEEEECCCCCCCCCCCCCCEEEECCCCCCCCCCCEEECCCCCCCCCC160 (460)
Q d20181218_281CAENIEGAKLYCNFWSDVANETFTETTYNFKLQITFLNYTRDPSGNLDYGTQMYAYYPGNGQGAGYSWYNYHQSNIMNPG160 (460)
T 1K7I_A81NAEQIEQAKLSLQSWSDVANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAGSSWYNYNQSNIRNPG160 (460)
T ss_pred81CHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCEEEEECCCCCCCCCCCCCEEEEECCCCCCCCCCEEEECCCCCCCCCC160 (460)
T ss_dssp81CHHHHHHHHHHHHHHHTTBSEEEEECCTTCCCSEEEEEECBCTTSCBCCSCCEEECCSSSSTTTTEEEEETTSHHHHCTT160 (460)
Q ss_pred161--------------------------------------------------------------CCCCC-CEEEEEEHHHHH240 (460)
Q d20181218_2161--------------------------------------------------------------AEEYG-RCEFTIDIGSAL240 (460)
T 1K7I_A161SEEYGRQTFTHEIGHALGLAHPGEYNAGEGDPSYNDAVYAEDSYQFSIMSFWGENETGADYNGHYGGAPMIDDIAAIQRL240 (460)
T ss_pred161CCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH240 (460)
T ss_dssp161TSHHHHHHHHHHHHHHHTCCCSSSCCSSSSCCCGGGCSSTTCSTTTCTTCSSCGGGGTCBCTTCCCCSCCHHHHHHHHHH240 (460)
Q ss_pred241CCCC-------------------------------------------------------------------------CCC320 (460)
Q d20181218_2241GDAH-------------------------------------------------------------------------NHE320 (460)
T 1K7I_A241YGANMTTRTGDSVYGFNSNTDRDFYTATDSSKALIFSVWDAGGTDTFDFSGYSNNQRINLNEGSFSDVGGLKGNVSIAHG320 (460)
T ss_pred241HCCCCCCCCCCCEEEECCCCCCCEEECCCCCCEEEEEEECCCCCEEEECCCCCCCEEEECCCCCCEEECCCCCCEEEECC320 (460)
T ss_dssp241HCBCTTTTCSCCEEETTCCSCCGGGBCSSTTCCCCEEECCCSSCCEEECTTCCSCCEEECSTTCEEBCTTCBSCEEECTT320 (460)
Q ss_pred321------C-----------------CCCCCC--------------------CCCCHHHHHHHCCEEEEECCC---------400 (460)
Q d20181218_2321------Y-----------------NAGEGD--------------------PSLNDKVSIELHYKFYIMSWQ---------400 (460)
T 1K7I_A321VTIENAIGGSGNDILVGNSADNILQGGAGNDVLYGGAGADTLYGGAGRDTFVYGSGQDSTVAAYDWIADFQKGIDKIDLS400 (460)
T ss_pred321CCCCEEECCCCCCEEECCCCCCEEECCCCCCEEEEECCCCEEECCCCCCEEEECCCCCCCCCCCCEEEECCCCCEEEEEE400 (460)
T ss_dssp321CCCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCSGGGSBGGGCEEETTCCTTTCEEECG400 (460)
Q ss_pred401-CCCC-CCCCCCC------------------------CCC-----CCCHHHHHHHHHHHC460 (460)
Q d20181218_2401-GENE-TGADMNG------------------------HRG-----GAMMHNDIAAIQRAY460 (460)
T 1K7I_A401AFRNEGQLSFVQDQFTGKGQEVMLQWDAANSITNLWLHEAGHSSVDFLVRIVGQAAQSDI460 (460)
T ss_pred401CCCCCCCEEEEEEEECCCCCCEEEEEECCCCEEEEEEECCCCCCCCEEEEECCCCCHHHE460 (460)
T ss_dssp401GGGGGCCCEEESSCCCSSSCEEEEEEETTTTEEEEEEECTTCSSCCEEEEEESCCCGGGE460 (460)


No 6
> 1GO7_P        Alignment in PIR format
MAC score = 85.62	Identity = 0.5

Download partial structureDownload full-length structure
Q ss_pred1CCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCC80 (460)
Q d20181218_21ANTSFAYNSVHDMLRICWWHDKNTVQRKTSYSIDCDAFQITRNKYCANSTNVENKSLTGYFDFLQDVSSIPWGDTGNVKF80 (460)
T 1GO7_P1ANTSSAYNSVYDFLRYHDRGDGLTVNGKTSYSIDQAAAQITRENVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKF80 (460)
T ss_pred1CCCCCCCCCCCCEEEEEECCCCCEECCCCCCCCCCCCCEEEECCCCCCCCCCCCCCEEEEEEECCCCCEECCCCCCEEEE80 (460)
T ss_dssp1CCCCHHHHHHHHHTTTTCCCTTCEETTEECCCHHHHHHHHTTTCEETTEESCCSCCEEEEEEECSCCSCCTTSCBCCBCC80 (460)
Q ss_pred81CHHHHHHHHHHHHHHHCCCCCEEEEECCCCCEEEEEEECCCCCCCCCCCCCCEEEECCCCCCCCCCCEEECCCCCCCCCC160 (460)
Q d20181218_281CAENIEGAKLYCNFWSDVANETFTETTYNFKLQITFLNYTRDPSGNLDYGTQMYAYYPGNGQGAGYSWYNYHQSNIMNPG160 (460)
T 1GO7_P81NAEQIEQAKLSLQSWSDVANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAGSSWYNYNQSNIRNPG160 (460)
T ss_pred81CCCCEEEEEECCCCEEEEECCCEEEEECCCCCCEEECCCCCCEEECCCCCCEEEECCCCCEEECCCCCEEEECCCCCCEE160 (460)
T ss_dssp81CHHHHHHHHHHHHHHHTTBSEEEEECCTTCCCSEEEEEECBCTTSCBCCSCCEEECCSSSSTTTTEEEEETTSHHHHCTT160 (460)
Q ss_pred161---------------------------------------------------------------CCCCCCEEEEEEHHHHH240 (460)
Q d20181218_2161---------------------------------------------------------------AEEYGRCEFTIDIGSAL240 (460)
T 1GO7_P161SEEYGRQTFTHKIGHALGLAHPGEYNAGEGDPSYNDAVYAEDSYQFSICSYWGENETGADYNGHYGGAPMIDDIAAIQRL240 (460)
T ss_pred161ECCCCCEEEEECCCCCEEECCCCCCCCCCCCCCEEECCCCCEEEEECCCCCEEECCCCCEEEEECCCCCEEEECCCCEEE240 (460)
T ss_dssp161TSHHHHHHHHHHHHHHHTCCCSSSCCTTSSCCCGGGCSBTTCSTTTCTTCSSCGGGGTCBCTTCCCCSCCHHHHHHHHHH240 (460)
Q ss_pred241CCCC-------------------------------------------------------------------------CC-320 (460)
Q d20181218_2241GDAH-------------------------------------------------------------------------NH-320 (460)
T 1GO7_P241YGANMTTRTGDSVYGFNSNTDRDFYTATDSSKALIFSVWDAGGTDTFDFSGYSNNQRINLNEGSFSDVGGLKGNVSIAHG320 (460)
T ss_pred241ECCCCEEEECCCEEEECCCCEEEEEECCCCCCCEEEEEEECCCCCEEEEEECCCCCEEECCCCCCEEECCCCCCEEEECC320 (460)
T ss_dssp241HCBCTTTTCSCCEEETTCCSCCGGGBCSSTTCCCCEEECCCSSCCEEECTTCCSCCEEECSTTCEEBCTTCBSCEEECTT320 (460)
Q ss_pred321---------CC-------------CCCCCC--CC-----------------C-CHHHHHHHCCEEEEECC----------400 (460)
Q d20181218_2321---------EY-------------NAGEGD--PS-----------------L-NDKVSIELHYKFYIMSW----------400 (460)
T 1GO7_P321VTIENAIGGSGNDILVGNSADNILQGGAGNDVLYGGAGADTLYGGAGRDTFVYGSGQDSTVAAYDWIADFQKGIDKIDLS400 (460)
T ss_pred321CCCCEEECCCCCCEEECCCCCCEEECCCCCCEEECCCCCCEEECCCCCCEEEECCCCCEEECCCCEEEECCCCCCEEEEE400 (460)
T ss_dssp321CCCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCSGGGSBGGGCEEECSCCTTTCEEECG400 (460)
Q ss_pred401CCCCC-CCCCCCC------------------------CCC-----CCCHHHHHHHHHHHC460 (460)
Q d20181218_2401QGENE-TGADMNG------------------------HRG-----GAMMHNDIAAIQRAY460 (460)
T 1GO7_P401AFRNEGQLSFVQDQFTGKGQEVMLQWDAANSITNLWLHEAGHSSVDFLVRIVGQAAQSDI460 (460)
T ss_pred401CCCCCEECCCCEEEEECCCCEEEEEECCCCCEEEEECCCCCCCCCEEEECCCCCCEEEEE460 (460)
T ss_dssp401GGGGGCCCEEESSCCCSSSCEEEEEEETTTTEEEEEEECTTCSSCCEEEEEESCCCGGGE460 (460)


No 7
> 1K7G_A        Alignment in PIR format
MAC score = 80.78	Identity = 0.49

Download partial structureDownload full-length structure
Q ss_pred1CCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCC80 (460)
Q d20181218_21ANTSFAYNSVHDMLRICWWHDKNTVQRKTSYSIDCDAFQITRNKYCANSTNVENKSLTGYFDFLQDVSSIPWGDTGNVKF80 (460)
T 1K7G_A1ANTSSAYNSVYDFLRYHDRGDGLTVNGKTSYSIDQAAAQITRENVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKF80 (460)
T ss_pred1CCCCCCCCCCCEEEECCCCCCCCEEECCCCCCCCCCCCCEEECCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCCEEEE80 (460)
T ss_dssp1UUUUUUUCHHHHHHTTTCCCTTCEETTEECCCHHHHHHHHTTTCEETTEESCCSCCEEEEEEECSCCSCCTTSCBCCBCC80 (460)
Q ss_pred81CHHHHHHHHHHHHHHHCCCCCEEEEECCCCCEEEEEEECCCCCCCCCCCCCCEEEECCCCCCCCCCCEEECCCCCCC---160 (460)
Q d20181218_281CAENIEGAKLYCNFWSDVANETFTETTYNFKLQITFLNYTRDPSGNLDYGTQMYAYYPGNGQGAGYSWYNYHQSNIM---160 (460)
T 1K7G_A81NAEQIEQAKLSLQSWSDVANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAGSSWYNYNQSNIRNPG160 (460)
T ss_pred81CCCCCEEEEEECCCEEEEECCCEEEEECCCCCCEEECCCCCCEEECCCCCCEEEECCCCCEEECCCCEEEEECCCCCEEE160 (460)
T ss_dssp81CHHHHHHHHHHHHHHHTTBSEEEEECCTTCCCSEEEEEECBCTTSCBCCSCCEEECCSSSSTTTTEEEEETTSHHHHCTT160 (460)
Q ss_pred161-----------------------------------------------------------CCC-CCCCCCEEEEEEHHHHH240 (460)
Q d20181218_2161-----------------------------------------------------------NPG-AEEYGRCEFTIDIGSAL240 (460)
T 1K7G_A161SEEYGRQTFTHEIGHALGLAHPGEYNAGEGDPSYNDAVYAEDSYQFSIMSYWGENETGADYNGHYGGAPMIDDIAAIQRL240 (460)
T ss_pred161ECCCCCEEEEECCCCCEEECCCCEEEEECCCCCCCCCCCCCEEEEECCCCEEEEECCCCCEEEECCCCCEEEECCCCCEE240 (460)
T ss_dssp161TSHHHHHHHHHHHHHHHTCCCSSSCCTTSSCCCGGGCSSTTCSTTTCTTCSSCGGGGTCBCTTCCCCSCCHHHHHHHHHH240 (460)
Q ss_pred241CCCCC-------------------------------------------------------------------------CC320 (460)
Q d20181218_2241GDAHN-------------------------------------------------------------------------HE320 (460)
T 1K7G_A241YGANMTTRTGDSVYGFNSNTDRDFYTATDSSKALIFSVWDAGGTDTFDFSGYSNNQRINLNEGSFSDVGGLKGNVSIAHG320 (460)
T ss_pred241ECCCCEEECCCCEEEEECCCCCEEEECCCCCCEEEEEEECCCCCCEEEEECCCCCEEEEECCCCCEEECCCCCCEEEECC320 (460)
T ss_dssp241HCBCTTTTCSCCEEETTCCSCCGGGBCSSTTCCCCEEECCCSSCCEEECTTCCSCCEEECSTTCEEBCTTCBSCEEECTT320 (460)
Q ss_pred321------C-----------------CCCCCC------------------CCCC--HHHHHHHCCEEEEECCC------CCC400 (460)
Q d20181218_2321------Y-----------------NAGEGD------------------PSLN--DKVSIELHYKFYIMSWQ------GEN400 (460)
T 1K7G_A321VTIENAIGGSGNDILVGNSADNILQGGAGNDVLYGGAGADTLYGGAGRDTFVYGSGQDSTVAAYDWIADFQKGIDKIDLS400 (460)
T ss_pred321CCCCEEECCCCCCEEECCCCCCEEECCCCCCEEECCCCCCEEECCCCCCEEEECCCCCEEECCCCEEECCCCCCCEEEEE400 (460)
T ss_dssp321CCCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCSGGGSBGGGCEEESSCCTTTCEEECG400 (460)
Q ss_pred401C---CC--CCCCC------------------------CCC-----CCCHHHHHHHHHHHC460 (460)
Q d20181218_2401E---TG--ADMNG------------------------HRG-----GAMMHNDIAAIQRAY460 (460)
T 1K7G_A401AFRNEGQLSFVQDQFTGKGQEVMLQWDAANSITNLWLHEAGHSSVDFLVRIVGQAAQSDI460 (460)
T ss_pred401CCCCCEECCCCEEEEEECCCEEEEEECCCCCEEEEECCCCCCCCCEEEECCCCCCEEEEE460 (460)
T ss_dssp401GGGGGSCCEEESSCCCSSSCEEEEEEETTTTEEEEEEECTTCSSCCEEEEEESCCCGGGE460 (460)


No 8
> 1SAT_A        Alignment in PIR format
MAC score = 70.31	Identity = 0.23

Download partial structureDownload full-length structure
Q ss_pred1CCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCCC--CCCCCCCCCCC80 (464)
Q d20181218_21NTSFAYNSVHDMLRICWWHDKNTVQRKTSYSIDCDAFQITRNKYCANSTNVENKSLTGYFDFLQDVS--SIPWGDTGNVK80 (464)
T 1SAT_A1AATTGYDAVDDLLHYHERGNGIQINGKDSFSNEQAGLFITRENQTWNGYKVFGQPVKLTFSFPDYKFSSTNVAGDTGLSK80 (464)
T ss_pred1CCCCCHHHHHHHHHHHCCCCCCEEEEEEEEECHHHCEEEECCCCCCCCCCCCCCEEEEEEEEECCCCCCCCCCCCCCEEE80 (464)
T ss_dssp1UUUCHHHHHHHHHTTTCCCTTCEETTEECCCHHHHHHHHTTTCCCTTCTTCCSCCEEEEEECCCCCTTCCCTTSCBSCBC80 (464)
Q ss_pred81CCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCEEEEEEEC--CCCCCC----------------CCCCCCCEEEECCCC-160 (464)
Q d20181218_281FCAENIEGAKLYCNFWSDVANETFTETTYNFKLQITFLNY--TRDPSG----------------NLDYGTQMYAYYPGN-160 (464)
T 1SAT_A81FSAEQQQQAKLSLQSWADVANITFTEVAAGQKANITFGNYSQDRPGHYDYGTQAYAFLPNTIWQGQDLGGQTWYNVNQSN160 (464)
T ss_pred81ECCCCEEEEEEEEEEEEEEECCCEEEEECCCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEEEEECCEEEEEECCC160 (464)
T ss_dssp81CCHHHHHHHHHHHHHHHHHBSEEEEECCTTSCCSEEEEEECEEETTEECCSCCEEECCTTCEETTEECTTEEEEETTSHH160 (464)
Q ss_pred161----CCCCC----------------------------------CC-------EEE-CCCCC-CCCCC-CCCCCCEEEEEE240 (464)
Q d20181218_2161----GQGAG----------------------------------YS-------WYN-YHQSN-IMNPG-AEEYGRCEFTID240 (464)
T 1SAT_A161VKHPATEDYGRQTFTHEIGHALGLSHPGDYNAGEGDPTYADVTYAEDTRQFSLMSYWSETNTGGDNGGHYAAAPLLDDIA240 (464)
T ss_pred161CCEEEECCCCCEEEECCCCCEEEECCCCCEEEECCCCCCEEEEECCCCEEEEEEECCCCCEEECCCCCEEEECCCCCCEE240 (464)
T ss_dssp161HHCTTTCHHHHHHHHHHHHHHHTCCCSSCCCSSSSCCCGGGCSBTTCSTTTCTTCCSCGGGGTCBCTTCCCCSCCHHHHH240 (464)
Q ss_pred241HHHHHCCCC-----------------------------------------------------------------------320 (464)
Q d20181218_2241IGSALGDAH-----------------------------------------------------------------------320 (464)
T 1SAT_A241AIQHLYGANLSTRTGDTVYGFNSNTGRDFLSTTSNSQKVIFAAWDAGGNDTFDFSGYTANQRINLNEKSFSDVGGLKGNV320 (464)
T ss_pred241EEECCCCEEEECCCCCEEEEEECCCCEEEEECCCCCCCEEEEEEEEECCCCEEEECCCCCCEEECCCCCCEEEECCCCCE320 (464)
T ss_dssp241HHHHHHCBCTTTTCSCCEEETTCCSCCGGGBCSSTTSCCCEEECCCSSCCEEECTTCCSCCEEECSTTCEEBCTTCBSCE320 (464)
Q ss_pred321--C----------CCC-------------CCCCCCCC-CC---HHHHHHHCCEEEEECCC-------------CCC----400 (464)
Q d20181218_2321--N----------HEY-------------NAGEGDPS-LN---DKVSIELHYKFYIMSWQ-------------GEN----400 (464)
T 1SAT_A321SIAAGVTIENAIGGSGNDVIVGNAANNVLKGGAGNDVLFGGGGADELWGGAGKDIFVFSAASDSAPGASDWIRDFQKGID400 (464)
T ss_pred321EEECCCCCCEEECCCCCCEEECCCCCCEEECCCCCCEEECCCCCCEEECCCCCCEEEECCCCCEEECCCCCEEEEECCCC400 (464)
T ss_dssp321EECTTCCCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCCGGGGCTTSCEEESSCCTTTS400 (464)
Q ss_pred401---------CC-----CCCCC---CC-------CC--------CCC------HHHHHHHHHHHC464 (464)
Q d20181218_2401---------ET-----GADMN---GH-------RG--------GAM------MHNDIAAIQRAY464 (464)
T 1SAT_A401KIDLSFFDKEANSSSFIHFVDHFSGTAGEALLSYNASSNVTDLSVNIGGHAAPDFLVKIVGQVD464 (464)
T ss_pred401CCEEEEECCCCCEEECCCCCEEEECCCCCEEEEECCCCCEEEEECCCCCCCCCCEEEEEECCCC464 (464)
T ss_dssp401EEECHHHHHHHTCTTSSEECSSCCSCTTEEEEEEETTTTEEEEEECSSCCSSCSEEEEEESCCC464 (464)


No 9
> 1SMP_A        Alignment in PIR format
MAC score = 65.02	Identity = 0.23

Download partial structureDownload full-length structure
Q ss_pred1CCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCC--CCCCCCCCCCCC80 (464)
Q d20181218_21NTSFAYNSVHDMLRICWWHDKNTVQRKTSYSIDCDAFQITRNKYCANSTNVENKSLTGYFDFLQDV--SSIPWGDTGNVK80 (464)
T 1SMP_A1AATTGYDAVDDLLHYHERGNGIQINGKDSFSNEQAGLFITRENQTWNGYKVFGQPVKLTFSFPDYKFSSTNVAGDTGLSK80 (464)
T ss_pred1CCCCCCCHHHHHHHHCCCCCCEEEECCCCCCCCCCCCEEECCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCCCCEEC80 (464)
T ss_dssp1UUUCHHHHHHHHHTTTCCCTTCEETTEECCCHHHHHHHHTTTCEETTEETCCSCCEEEEEECCCCCTTCBCTTSCBSCBC80 (464)
Q ss_pred81CCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCEEEEEEEC--CCCCCC----------------CCCCCCCEEEECCCC-160 (464)
Q d20181218_281FCAENIEGAKLYCNFWSDVANETFTETTYNFKLQITFLNY--TRDPSG----------------NLDYGTQMYAYYPGN-160 (464)
T 1SMP_A81FSAEQQQQAKLSLQSWADVANITFTEVAAGQKANITFGNYSQDRPGHYDYGTQAYAFLPNTIWQGQDLGGQTWYNVNQSN160 (464)
T ss_pred81CCHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCEEEECCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCEEECCCCCE160 (464)
T ss_dssp81CCHHHHHHHHHHHHHHHHHBSEEEEECCTTSCCSEEEEEECEEETTEECCSCCEEECCTTCEETTEECTTEEEEETTSHH160 (464)
Q ss_pred161--------------------------------CCCC------CC------------------------------------240 (464)
Q d20181218_2161--------------------------------GQGA------GY------------------------------------240 (464)
T 1SMP_A161VKHPATEDYGRQTFTHEIGHALGLSHPGDYNAGEGNPTYNDVTYAEDTRQFSLMSYWSETNTGGDNGGHYAAAPLLDDIA240 (464)
T ss_pred161EECCCCCCEEEEEECCCCEEEEECCCCCCEECCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCC240 (464)
T ss_dssp161HHCTTTCHHHHHHHHHHHHHHHTCCCSSSCCTTSSCCCGGGCSBTTCSTTTCTTCCSCGGGGTCBCTTCCCCSCCHHHHH240 (464)
Q ss_pred241----------------CEEECCCC----CCCCCCCCCCCC-----------------------------EEEEE--EHHH320 (464)
Q d20181218_2241----------------SWYNYHQS----NIMNPGAEEYGR-----------------------------CEFTI--DIGS320 (464)
T 1SMP_A241AIQHLYGANLSTRTGDTVYGFNSNTGRDFLSTTSNSQKVIFAAWDAGGNDTFDFSGYTANQRINLNEKSFSDVGGLKGNV320 (464)
T ss_pred241EEEECCCCCCEEECCCCEEEEECCCCCEEEECCCCCEEEEEECCCCCCCCCEEEEECCCCCEEEECCCCCEEEECCCCCE320 (464)
T ss_dssp241HHHHHHCBCTTTTCSCCEEETTCCSCCGGGBCSSTTSCCCEEECCCSSCCEEECTTCCSCCEEECSTTCEEBCTTCBSCE320 (464)
Q ss_pred321HHCC------CCCCCC-------------CCCCC---------CCCCC-----------HHHHHHHCCEEEEECC-----400 (464)
Q d20181218_2321ALGD------AHNHEY-------------NAGEG---------DPSLN-----------DKVSIELHYKFYIMSW-----400 (464)
T 1SMP_A321SIAAGVTIENAIGGSGNDVIVGNAANNVLKGGAGNDVLFGGGGADELWGGAGKDIFVFSAASDSAPGASDWIRDFQKGID400 (464)
T ss_pred321EEECCCCCCEEECCCCCCEEECCCCCCEEECCCCCCEEECCCCCCEEECCCCCCEEEECCCCCEEECCCCCEEEEECCCC400 (464)
T ss_dssp321EECTTCCCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCCGGGGBTTBCEEESSCCTTTS400 (464)
Q ss_pred401-----CCCCCC-----CCCCC---CC-------CC--------CCC------HHHHHHHHHHHC464 (464)
Q d20181218_2401-----QGENET-----GADMN---GH-------RG--------GAM------MHNDIAAIQRAY464 (464)
T 1SMP_A401KIDLSFFNKEANSSDFIHFVDHFSGTAGEALLSYNASSNVTDLSVNIGGHQAPDFLVKIVGQVD464 (464)
T ss_pred401CCEEEECCCCCCEEECCCCCCEEECCCCEEEEEEECCCCEEEEECCCCCCCCCCEEEEECCCCE464 (464)
T ss_dssp401EEECHHHHHHTTCTTSSEECSSCCSCTTEEEEEEETTTTEEEEEEETTCCSSCSEEEEEESCCC464 (464)


No 10
> 1AF0_A        Alignment in PIR format
MAC score = 58.69	Identity = 0.24

Download partial structureDownload full-length structure
Q ss_pred1CCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCCC--CCCCCCCCCCC80 (470)
Q d20181218_21NTSFAYNSVHDMLRICWWHDKNTVQRKTSYSIDCDAFQITRNKYCANSTNVENKSLTGYFDFLQDVS--SIPWGDTGNVK80 (470)
T 1AF0_A1AATTGYDAVDDLLHYHERGNGIQINGKDSFSNEQAGLFITRENQTWNGYKVFGQPVKLTFSFPDYKFSSTNVAGDTGLSK80 (470)
T ss_pred1CCCCCCCCHHHHHHHCCCCCCEEECCCCCEEECCCCCEEEECCCCCCCCCCCCCEEEEEEEEECCCCCCCCCCCCCCEEE80 (470)
T ss_dssp1UCCCHHHHHHHHHTTTCCCTTCEETTEECCCHHHHHHHHTTTCCCTTCTTCCSCCEEEEEECCCCCTTCBCTTSCBSCBC80 (470)
Q ss_pred81CCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCEEEEEEEC--CCCCCC----------------CCCCCCCEEEECCCC-160 (470)
Q d20181218_281FCAENIEGAKLYCNFWSDVANETFTETTYNFKLQITFLNY--TRDPSG----------------NLDYGTQMYAYYPGN-160 (470)
T 1AF0_A81FSAEQQQQAKLSLQSWADVANITFTEVAAGQKANITFGNYSQDRPGHYDYGTQAYAFLPNTIWQGQDLGGQTWYNVNQSN160 (470)
T ss_pred81ECCCCEEEEEEECCEEEEECCCEEEEEECCCCCCEEECCCCCCCCCCCCCCCEEEEECCCCCCCCCEEECCEEEEEECCC160 (470)
T ss_dssp81CCHHHHHHHHHHHHHHHHHBSEEEEECCTTSCCSEEEEEECEEETTEECCSCCEEECCTTCEETTEECTTEEEEETTSHH160 (470)
Q ss_pred161----CCCCC----------------------------------C-------CEEE-CCCCC-CCCCC-CCCCCCEEEEEE240 (470)
Q d20181218_2161----GQGAG----------------------------------Y-------SWYN-YHQSN-IMNPG-AEEYGRCEFTID240 (470)
T 1AF0_A161VKHPATEDYGRQTFTHEIGHALGLSHPGDYNAGEGDPTYNDVTYAEDTRQFSLMSYWSETNTGGDNGGHYAAAPLLDDIA240 (470)
T ss_pred161CCEEEECCCCCEEEECCCCCEEEECCCCCEEEECCCCCCEEEECCCCCCEEEEEEECCCCEEEECCCCEEEECCCCCCEE240 (470)
T ss_dssp161HHCTTTCHHHHHHHHHHHHHHHTCCCSSSCCTTSSCCCGGGCSSTTCSTTTCTTCCSCGGGGTCBCTTCCCCSCCHHHHH240 (470)
Q ss_pred241HHHHHCCCC-----------------------------------------------------------------------320 (470)
Q d20181218_2241IGSALGDAH-----------------------------------------------------------------------320 (470)
T 1AF0_A241AIQHLYGANLSTRTGDTVYGFNSNTGRDFLSTTSNSQKVIFAAWDAGGNDTFDFSGYTANQRINLNEKSFSDVGGLKGNV320 (470)
T ss_pred241EECCCCCCCEEEECCCCEEEEECCCCCEEEECCCCCEEEEECCCCCCCCCCEEEEECCCCCEEECCCCCCEEEECCCCCE320 (470)
T ss_dssp241HHHHHHCBCTTTTCSCCEEETTCCSCCGGGBCSSTTSCCCEEECCCSSCCEEECTTCCSCCEEECSTTCEEBCTTCBSCE320 (470)
Q ss_pred321--CCCC-----C------------------CCCCCC--C-------CC-----------HHHHHHHCCEEE---------400 (470)
Q d20181218_2321--NHEY-----N------------------AGEGDP--S-------LN-----------DKVSIELHYKFY---------400 (470)
T 1AF0_A321SIAAGVTIENAIGGSGNDVIVGNAANNVLKGGAGNDVLFGGGGADELWGGAGKDIFVFSAASDSAPGASDWIRDFQKGID400 (470)
T ss_pred321EEECCCCCCEEECCCCCCEEECCCCCCEEECCCCCCEEECCCCCCEEECCCCCCEEEECCCCCEEECCCCCEEEECCCCC400 (470)
T ss_dssp321EECTTCCCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCSSCCEEECCSGGGGCTTSCEEECSCCTTTS400 (470)
Q ss_pred401-EECCCCCCCC----C-CCC---CCC-------CC--------CC--------CHHHHHHHHHH----HC470 (470)
Q d20181218_2401-IMSWQGENET----G-ADM---NGH-------RG--------GA--------MMHNDIAAIQR----AY470 (470)
T 1AF0_A401KIDLSFFDKEANSSSFIHFVDHFSGTAGEALLSYNASSNVTDLSVNIGGHQAPDFLVKIVGQVDVATDFI470 (470)
T ss_pred401CCEEEECCCCCCEEEECCCCEEEECCCCCEEEEECCCCCEEEEECCCCCCCCCEEEEEEECCCCCCCCEE470 (470)
T ss_dssp401EEECHHHHHHHTCTTSSEECSSCCSCTTEEEEEEETTTTEEEEEECSSCCSSCSEEEEEESCCCTTTSEE470 (470)