TreeThreader - Results

  Job information

Job ID: d20181120
#Proteins: 4
Protein ID: d20181120_4
Fasta ID: seq4
Submission time: 2018-11-20 10:54:03 +0800
Finished time: 2019-02-17 22:24:26 +0800
Identical Job(s): NULL

  Alignments

1
50
100
150
200
250
300
350
400
443
1DO0_A 1DO0_A 1HT1_E 1HT1_E 1G4A_E 1G4A_E 1KYI_A 1KYI_A 1OFH_A 1OFH_A 3HWS_A 3HWS_A 3HTE_A 3HTE_A 1UM8_A 1UM8_A 2QZ4_A 2QZ4_A 3SYK_A 3SYK_A

  Build multi-template model (choose up to 5 templates)

                   
Download full-length structure

  Top 10 hits

Query:
Job ID  : d20181120_4
Length : 443
Sequence: SEMTPREIVSEKDQFICGDADAKRSVDIGNRNRWRNMQDQKPLRCEVTPKNILMIGPTGVEKTEIARWLAKLYIAPFIKS TATMFTWVGYVGKEVDPLIRDLTWWAGKGHLLHLPANPWNVSMINEKHMDVQHSEPCRHNKNWHGFESSGLFCRFHYPHW AHPVEMFSVRRHCELEKGREKDPNYELNYQAWVFLCCNQSYYYRLATCHVPGQPMPDQGFSIITVPEAHKSDINSNFGET IRARDAVHQNGSRFDREIDKGCGTGECSIADCSKTGVQRDVLPLVERINVSTKPGMVKMCHILFIVFWMFLVARESDLIP PLGQFLPIRVFLTALSACDFERILTMPHRSMRENYKALMQQEGVNIMFTTDAVWKIAEAAFYVCPKTENIGARRLHVVME RLMWKISFSASCKNGQAWNIDGELQADAYPQVVRNDDLSRFIL

No Hit MAC Score Identity Cols Query HMM Template HMM
11DO0_A261.990.484251-4431-442
21HT1_E260.480.494241-4438-449
31G4A_E254.250.533931-4432-443
41KYI_A240.570.593971-4432-444
51OFH_A186.530.633091-4432-310
63HWS_A184.120.233541-4432-359
73HTE_A180.30.223571-4432-360
81UM8_A173.430.233501-4438-376
92QZ4_A82.270.142609-4421-262
103SYK_A80.840.152681-44318-303

  Pairwise Query-Template Alignment

No 1
> 1DO0_A        Alignment in PIR format
MAC score = 261.99	Identity = 0.48

Download partial structureDownload full-length structure
Q ss_pred1CCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHCCCCEEEE80 (460)
Q d20181120_41SEMTPREIVSEKDQFICGDADAKRSVDIGNRNRWRNMQDQKPLRCEVTPKNILMIGPTGVEKTEIARWLAKLYIAPFIKS80 (460)
T 1DO0_A1SEMTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKV80 (460)
T ss_pred1CCCCHHHHHHHHHHCEECHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCEEEE80 (460)
T ss_dssp1CCCCHHHHHHHHTTTCCSCHHHHHHHHHHHHHHHHHTTSCHHHHTTCCCCCEEEECCTTSSHHHHHHHHHHHHTCCEEEE80 (460)
Q ss_pred81EECCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCC-CCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC160 (460)
Q d20181120_481TATMFTWVGYVGKEVDPLIRDLTWWAGKGHLLHL-PANPWNV-SMINEKHMDVQHSEPCRHNKNWHGFESSGLFCRFHYP160 (460)
T 1DO0_A81EATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPA----KNNW-----GQ-----TE160 (460)
T ss_pred81EEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHCCCC----CCCC-----CH-----HC160 (460)
T ss_dssp81EGGGGCCSSSCCCCTHHHHHHHHHHHHHHHHHHHHHHSHHHHHHHHHHTTHHHHSCCC----SCCC-----CS-----SC160 (460)
Q ss_pred161CCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCC------CCCC-CCC-CCCCCCCCC-240 (460)
Q d20181120_4161HWAHPVEMFSVRRHCELEKGREKDPNYELNYQAWVFLCCNQSYYYRLATCHVPGQ------PMPD-QGF-SIITVPEAH-240 (460)
T 1DO0_A161QQQEP-SAARQAFRKKLREG--QLDDKEIEIDLAAAPMGVE-IMAPPGMEEMTSQLQSMFQNLGGQKQKARKLKIKDAMK240 (460)
T ss_pred161CCCCH-HHCCHHHHHHHHCC--CCCCCEEEEEECCCCCCCC-CCCCCCHHHHHHHHHHHHHCCCCCCCCCEECCHHHHHH240 (460)
T ss_dssp161SSSSS-HHHHHHHHHHHHTS--CCCCEEECCCUUUUUUUUU-UUUUUUUUUUUUUUUUUUUUUUUUUUUCEEECHHHHHH240 (460)
Q ss_pred241------CCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCHHH320 (460)
Q d20181120_4241------KSDINSNFGETIRARDAVHQNGSRFDREIDKGCGTGECSIADCSKTGVQRDVLPLVERINVSTKPGMVKMCHIL320 (460)
T 1DO0_A241LLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESSGPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHIL320 (460)
T ss_pred241HHHHHHHHHHHCHHHHHHHHHHHHHHCCCEECCCCCCCCCCCCCCCHHHHHCCCHHHHHHHCCCCCCCCCCCCCCCCCCC320 (460)
T ss_dssp241HHHHHHHHHHCCHHHHHHHHHHHHHHHCEEEEETTTTTSCCSSCSHHHHHHHHHHHHHHHHHHCCEEEETTEEEEGGGCE320 (460)
Q ss_pred321HHHHHHHHHCCCCCCCCCCCCCCCCEEECCCCCHHHHHHHHHCCCCHHHHHHHHHHHHCCCEEEECHHHHHHHHHHHHHH400 (460)
Q d20181120_4321FIVFWMFLVARESDLIPPLGQFLPIRVFLTALSACDFERILTMPHRSMRENYKALMQQEGVNIMFTTDAVWKIAEAAFYV400 (460)
T 1DO0_A321FIASGAFQIAKPSDLIPELQGRLPIRVELQALTTSDFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQV400 (460)
T ss_pred321CCCCCHHHHCCCCCCCHHHHCCCCCEEECCCCCHHHHHHHHCCCHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHHHHHH400 (460)
T ss_dssp321EEEEECCSSSCGGGSCHHHHHTCCEEEECCCCCHHHHHHHHHSSTTCHHHHHHHHHHTTTCEEEECHHHHHHHHHHHHHH400 (460)
Q ss_pred401CCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCEEEECHHHHHHHHHHHHHCCCCCCCCC460 (460)
Q d20181120_4401CPKTENIGARRLHVVMERLMWKISFSASCKNGQAWNIDGELQADAYPQVVRNDDLSRFIL460 (460)
T 1DO0_A401NESTENIGARRLHTVLERLMEEISYDASDLSGQNITIDADYVSKHLDALVADEDLSRFIL460 (460)
T ss_pred401HCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCEEEECHHHHCCCCCHHHHHHHHHHCCC460 (460)
T ss_dssp401HHHSCCCTTHHHHHHHHHHHHHHHHHGGGGTTCEEEECHHHHHHHHHHHHHCHHHHTTCC460 (460)


No 2
> 1HT1_E        Alignment in PIR format
MAC score = 260.48	Identity = 0.49

Download partial structureDownload full-length structure
Q ss_pred1CCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHCCCCEEEE80 (461)
Q d20181120_41SEMTPREIVSEKDQFICGDADAKRSVDIGNRNRWRNMQDQKPLRCEVTPKNILMIGPTGVEKTEIARWLAKLYIAPFIKS80 (461)
T 1HT1_E1SEMTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKV80 (461)
T ss_pred1CCCCHHHHHHHHHHCEECCHHCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCEEEE80 (461)
T ss_dssp1CCCCHHHHHHHHHTTCCSCHHHHHHHHHHHHHHHHHHTSCHHHHHHCCCCCEEEECCTTSSHHHHHHHHHTTTTCCEEEE80 (461)
Q ss_pred81EECCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCC-CCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC160 (461)
Q d20181120_481TATMFTWVGYVGKEVDPLIRDLTWWAGKGHLLHLP-ANPWNV-SMINEKHMDVQHSEPCRHNKNWHGFESSGLFCRFHYP160 (461)
T 1HT1_E81EATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPA-KNNW------GQ--------T160 (461)
T ss_pred81EEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHCCCC-CCCC------CH--------H160 (461)
T ss_dssp81EGGGGGGHHHHCCCTTHHHHHHHHHHHHHHTTTHHHHTTTTTTTHHHHHHHTTTSCCC-SSCC------SS--------S160 (461)
Q ss_pred161CCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHCCCCCCCC-CCCCCCCCCC--------CCCCCCCCCCCCCCCC240 (461)
Q d20181120_4161HWAHPVEMFSVRRHCELEKGREKDPNYELNYQAWVFLCCNQSYYY-RLATCHVPGQ--------PMPDQGFSIITVPEAH240 (461)
T 1HT1_E161EQQQEP---SAARQAFRKKLREGQ-LDDKEIEIDLAAAPMGVEIMAPPGMEEMTSQLQSMFQNLGGQKQKARKLKIKDAM240 (461)
T ss_pred161HCCCCC---CCCCHHHHHHHHHCC-CCCCEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCEEECHHHHH240 (461)
T ss_dssp161SSSSSC---TTHHHHHHHTTSSCC-CCCCCBCUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUCCCCBCCCHHHHH240 (461)
Q ss_pred241----CCC---CCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCHH320 (461)
Q d20181120_4241----KSD---INSNFGETIRARDAVHQNGSRFDREIDKGCGTGECSIADCSKTGVQRDVLPLVERINVSTKPGMVKMCHI320 (461)
T 1HT1_E241KLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESSGPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHI320 (461)
T ss_pred241HHHHHHHHHHHHCHHCCCHHHHHHHHCCCCEEECCCCEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCEECCCCCH320 (461)
T ss_dssp241HHHHHHHHHTTSCHHHHHHHHHHHHHHHCEEEEETGGGGSCCTTCSHHHHHHHHHHHHHHHHHHCCEEEETTEEEECTTC320 (461)
Q ss_pred321HHHHHHHHHHCCCCCCCCCCCCCCCCEEECCCCCHHHHHHHHHCCCCHHHHHHHHHHHHCCCEEEECHHHHHHHHHHHHH400 (461)
Q d20181120_4321LFIVFWMFLVARESDLIPPLGQFLPIRVFLTALSACDFERILTMPHRSMRENYKALMQQEGVNIMFTTDAVWKIAEAAFY400 (461)
T 1HT1_E321LFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTSDFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQ400 (461)
T ss_pred321HHHCCCCHHHCCCCCCCHHHCCCCCEEEECCCCCHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEEECHHHHHHHHHHHHH400 (461)
T ss_dssp321EEEEEECCSSSCGGGSCHHHHHHCCEEEECCCCCHHHHHHHHHSSTTCHHHHHHHHHHTTTCEEEECHHHHHHHHHHHHH400 (461)
Q ss_pred401HCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCEEEECHHHHHHHHHHHHHCCCCCCCCC461 (461)
Q d20181120_4401VCPKTENIGARRLHVVMERLMWKISFSASCKNGQAWNIDGELQADAYPQVVRNDDLSRFIL461 (461)
T 1HT1_E401VNESTENIGARRLHTVLERLMEEISYDASDLSGQNITIDADYVSKHLDALVADEDLSRFIL461 (461)
T ss_pred401HHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEECHHHHCCCCCHHHHHCCCHHCCC461 (461)
T ss_dssp401HHHHSCCCTTHHHHHHHHHHHHHHHHHGGGGTTCEEEECHHHHHHHHHHHHHCHHHHHHHC461 (461)


No 3
> 1G4A_E        Alignment in PIR format
MAC score = 254.25	Identity = 0.53

Download partial structureDownload full-length structure
Q ss_pred1CCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHCCCCEEEE80 (492)
Q d20181120_41SEMTPREIVSEKDQFICGDADAKRSVDIGNRNRWRNMQDQKPLRCEVTPKNILMIGPTGVEKTEIARWLAKLYIAPFIKS80 (492)
T 1G4A_E1SEMTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKV80 (492)
T ss_pred1CCCCHHHHHHHHHHCEECHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCEEEE80 (492)
T ss_dssp1CCCCHHHHHHHHHHHCCSCHHHHHHHHHHHHHHHHHTTSCHHHHTTSCCCCEEEECCTTSSHHHHHHHHHHHHTCCEEEE80 (492)
Q ss_pred81EECCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC160 (492)
Q d20181120_481TATMFTWVGYVGKEVDPLIRDLTWWAGKGHLLHLPANPWNVSMINEKHMDVQHSEPCRHNKNWHGFESSGLFCRFHYPHW160 (492)
T 1G4A_E81EATKFTEVGYVGKEVDSIIRDLTDAAVKM-------------------VRVQAIE-------------------------160 (492)
T ss_pred81EEECCCCCCCCHHHHHHHHHHHHHHHHHH-------------------HHHHHHH-------------------------160 (492)
T ss_dssp81ETTGGGCTTTCCCCGGGGHHHHTTHHHHT-------------------TTTSSTT-------------------------160 (492)
Q ss_pred161CCCCHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHH-------CCCC-------CCCCC-------CCCCCCCCCCC----240 (492)
Q d20181120_4161AHPVEMFSVRRHCELEKGREKDPNYELNYQAWVFL-------CCNQ-------SYYYR-------LATCHVPGQPM----240 (492)
T 1G4A_E161----K-NRYRAEELAEE-RILDVLIPPAKNNWGQTEQQQEPSAARQAFRKKLREGQLDDKEIEIDLAAAPMGVEIMAPPG240 (492)
T ss_pred161----H-HHHHHHHHCCC-CHHHHHCCCCCCCCCHHHCCCCHHHCCHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCCCCC240 (492)
T ss_dssp161----T-THHHHHSHHHH-TTCUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU240 (492)
Q ss_pred241----CCC--------CC-----CCCC----CCCCC---CCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCC320 (492)
Q d20181120_4241----PDQ--------GF-----SIIT----VPEAH---KSDINSNFGETIRARDAVHQNGSRFDREIDKGCGTGECSIAD320 (492)
T 1G4A_E241MEEMTSQLQSMFQNLGGQKQKARKLKIKDAMKLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESSGPD320 (492)
T ss_pred241HHHHHHHHHHHHCCCCCCCCCCEECCHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHCCCEECCCCCCCCCCCCCCCCC320 (492)
T ss_dssp241UUUUUUUUUUUUUUUUUUUUUUUUUUUUCCTTHHHHTHHHHSCCSTHHHHTTTTHHHHSCEEEEECCTTSSSCCSTTCCC320 (492)
Q ss_pred321CCCCCCCCCCCCCEECCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEECCCCCHHHHHHHHHCCCCHH400 (492)
Q d20181120_4321CSKTGVQRDVLPLVERINVSTKPGMVKMCHILFIVFWMFLVARESDLIPPLGQFLPIRVFLTALSACDFERILTMPHRSM400 (492)
T 1G4A_E321VSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTSDFERILTEPNASI400 (492)
T ss_pred321CHHCCCHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCHHHHCCCCCCCHHHHCCCCCEEECCCCCHHHHHHHHCCCCHHH400 (492)
T ss_dssp321SHHHHHHHTTHHHHHCCEEEETTEEEEGGGCEEEECCCCSSSCGGGSCHHHHHTCCEEEECCCCCHHHHHHHHHSSTTCH400 (492)
Q ss_pred401HHHHHHHHHHCCCEEEECHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCEEEECHHHHHHHHHH480 (492)
Q d20181120_4401RENYKALMQQEGVNIMFTTDAVWKIAEAAFYVCPKTENIGARRLHVVMERLMWKISFSASCKNGQAWNIDGELQADAYPQ480 (492)
T 1G4A_E401TVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISYDASDLSGQNITIDADYVSKHLDA480 (492)
T ss_pred401HHHHHHHHHHCCCEEEECHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEECHHHHCCCCCH480 (492)
T ss_dssp401HHHHHHHTTTTTCCCCBCHHHHHHHHHHHHHHHHHSCCCCTHHHHHHHHHTSHHHHHHTTTTTTCCCCBCHHHHGGGTHH480 (492)
Q ss_pred481HHHCCCCCCCCC492 (492)
Q d20181120_4481VVRNDDLSRFIL492 (492)
T 1G4A_E481LVADEDLSRFIL492 (492)
T ss_pred481HHHCCCCCCCCC492 (492)
T ss_dssp481HHHCTTTHHHHC492 (492)


No 4
> 1KYI_A        Alignment in PIR format
MAC score = 240.57	Identity = 0.59

Download partial structureDownload full-length structure
Q ss_pred1CCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHCCCCEEEE80 (489)
Q d20181120_41SEMTPREIVSEKDQFICGDADAKRSVDIGNRNRWRNMQDQKPLRCEVTPKNILMIGPTGVEKTEIARWLAKLYIAPFIKS80 (489)
T 1KYI_A1SEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKV80 (489)
T ss_pred1CCCCHHHHHHHHHCCEECHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCEEEE80 (489)
T ss_dssp1CCCCHHHHHHHHHTTCCSCHHHHHHHHHHHHHHHHTTSSCSHHHHHCCCCCEEEECCTTSSHHHHHHHHHHHHTCCEEEE80 (489)
Q ss_pred81EECCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCC160 (489)
Q d20181120_481TATMFTWVGYVGKEVDPLIRDLTWWAGKGHLLHLPANPWNVSMINEKHMDVQHSEPCRHNKNWHGFESS---GLFCRFHY160 (489)
T 1KYI_A81EATKFTEVGYVGKEVDSIIRDLTDSAM--------------KLVRQQEIA-KN---------RARAEDVAEERILDALLP160 (489)
T ss_pred81EEECCCCCCCCCHHHHHHHHHHHHHHH--------------HHHHHHHHH-HH---------HHHHHHHHHHHHHHHHCC160 (489)
T ss_dssp81EGGGGCUUUUUUUCTTHHHHHHHHHHH--------------HHHHHHHHT-TC---------UUUUUUUUUUUUUUUUUU160 (489)
Q ss_pred161CCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHCCCCCCCCC----C-CCCC-----CCCCCC------C----C240 (489)
Q d20181120_4161PHWAHPVEMFSVRRHCELEKGREKDPNYELNYQAWVFLCCNQSYYYR----L-ATCH-----VPGQPM------P----D240 (489)
T 1KYI_A161P--AK--NQW-----------------GEVEN-HDSHSSTRQAFRKKLREGQLDDKEIEIDVSAGVSMGVEIMAPPGMEE240 (489)
T ss_pred161C--CC--CCC-----------------CCCCC-CCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCCCCCCCCC240 (489)
T ss_dssp161U--UU--UUU-----------------UUUUU-UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU240 (489)
Q ss_pred241---C------CC-CC------CCC-------CCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCC320 (489)
Q d20181120_4241---Q------GF-SI------ITV-------PEAHKSDINSNFGETIRARDAVHQNGSRFDREIDKGCGTGECSIADCSK320 (489)
T 1KYI_A241MTNQLQSLFQNLGSDKTKKRKMKIKDALKALIDDEAAKLINPEELKQKAIDAVEQNGIVFIDEIDKICKKGEYSGADVSR320 (489)
T ss_pred241CCCCHHHHHHHCCCCCCCHHHCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCEEHHHHHHHHCCCCCCCCCCCH320 (489)
T ss_dssp241UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUCCCCCCHHHHHHHHHHHHHHHCEEEEECGGGGSCCUUUUCTHHHH320 (489)
Q ss_pred321CCCCCCCCCCEECCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEECCCCCHHHHHHHHHCCCCHHHHH400 (489)
Q d20181120_4321TGVQRDVLPLVERINVSTKPGMVKMCHILFIVFWMFLVARESDLIPPLGQFLPIRVFLTALSACDFERILTMPHRSMREN400 (489)
T 1KYI_A321EGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAADFERILTEPHASLTEQ400 (489)
T ss_pred321HHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHCCCCHHCCHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCHHHHHHHH400 (489)
T ss_dssp321HHHHHHHHHHHHCCEEEETTEEEEGGGCEEEEEECCSSSCGGGSCHHHHTSCCEEEECCCCCHHHHHHHTTSSTTCHHHH400 (489)
Q ss_pred401HHHHHHHCCCEEEECHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCEEEECHHHHHHHHHHHHH480 (489)
Q d20181120_4401YKALMQQEGVNIMFTTDAVWKIAEAAFYVCPKTENIGARRLHVVMERLMWKISFSASCKNGQAWNIDGELQADAYPQVVR480 (489)
T 1KYI_A401YKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISFSASDMNGQTVNIDAAYVADALGEVVE480 (489)
T ss_pred401HHHHHHHCCCEEEECHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEECHHHHCCCCCHHHH480 (489)
T ss_dssp401HHHHHHHTTCEEEECHHHHHHHHHHHHHHHHHSCCCTTHHHHHHHHHHSHHHHHHGGGGTTCEEEECHHHHHHHTCCCCC480 (489)
Q ss_pred481CCCCCCCCC489 (489)
Q d20181120_4481NDDLSRFIL489 (489)
T 1KYI_A481NEDLSRFIL489 (489)
T ss_pred481HHHHHHCCC489 (489)
T ss_dssp481CCCTGGGBC489 (489)


No 5
> 1OFH_A    ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A*     Alignment in PIR format
MAC score = 186.53	Identity = 0.63

Download partial structureDownload full-length structure
Q ss_pred1CCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHCCCCEEEE80 (443)
Q d20181120_41SEMTPREIVSEKDQFICGDADAKRSVDIGNRNRWRNMQDQKPLRCEVTPKNILMIGPTGVEKTEIARWLAKLYIAPFIKS80 (443)
T 1OFH_A1SEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKV80 (443)
T ss_pred1CCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCCHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEE80 (443)
T ss_dssp1CCCCHHHHHHHHHTTCCSCHHHHHHHHHHHHHHHHTTSSCHHHHHHCCCCCEEEECCTTSSHHHHHHHHHHHHTCCEEEE80 (443)
Q ss_pred81EECCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC160 (443)
Q d20181120_481TATMFTWVGYVGKEVDPLIRDLTWWAGKGHLLHLPANPWNVSMINEKHMDVQHSEPCRHNKNWHGFESSGLFCRFHYPHW160 (443)
T 1OFH_A81EATKFTEVGYVGKEVDSIIRDLTDSAGGAIDA-V--EQNGIVFIDEIDKICKKG-------EY--------------SG-160 (443)
T ss_pred81ECHHHCCCCCCCCCHHHHHHHHHHHHHHHHHH-C--CCCCEEEEECHHHHCCCC-------CC--------------CC-160 (443)
T ss_dssp81EGGGGSSCCSGGGSTTHHHHHHHHTTTTCHHH-H--HHHCEEEEECGGGGSCCS-------SC--------------CS-160 (443)
Q ss_pred161CCCCHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH240 (443)
Q d20181120_4161AHPVEMFSVRRHCELEKGREKDPNYELNYQAWVFLCCNQSYYYRLATCHVPGQPMPDQGFSIITVPEAHKSDINSNFGET240 (443)
T 1OFH_A161A-DVSRE-----------------------------------------------------------------------GV240 (443)
T ss_pred161C-CHHHH-----------------------------------------------------------------------HH240 (443)
T ss_dssp161S-HHHHH-----------------------------------------------------------------------HH240 (443)
Q ss_pred241HHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCC320 (443)
Q d20181120_4241IRARDAVHQNGSRFDREIDKGCGTGECSIADCSKTGVQRDVLPLVERINVSTKPGMVKMCHILFIVFWMFLVARESDLIP320 (443)
T 1OFH_A241QRDLLPLVEGSTVSTKH------------------G-------------------MVKTDHILFIASGAFQVARPSDLIP320 (443)
T ss_pred241HHHHHHHHCCCCCCCCC------------------C-------------------CCCCCCEEEEEECCCCCCCCHHCCH320 (443)
T ss_dssp241HHHHHHHHHCCEEEETT------------------E-------------------EEECTTCEEEEEECCSSSCGGGSCH320 (443)
Q ss_pred321CCCCCCCCEEECCCCCHHHHHHHHHCCCCHHHHHHHHHHHHCCCEEEECHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHH400 (443)
Q d20181120_4321PLGQFLPIRVFLTALSACDFERILTMPHRSMRENYKALMQQEGVNIMFTTDAVWKIAEAAFYVCPKTENIGARRLHVVME400 (443)
T 1OFH_A321ELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVME400 (443)
T ss_pred321HHHHCCCCEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEECCHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHH400 (443)
T ss_dssp321HHHHTCCEEEECCCCCHHHHHHHHHSSTTCHHHHHHHHHHHTTCEEEECHHHHHHHHHHHHHHHHHSCCCTTHHHHHHHH400 (443)
Q ss_pred401HHHHHHCCCCCCCCCCEEEECHHHHHHHHHHHHHCCCCCCCCC443 (443)
Q d20181120_4401RLMWKISFSASCKNGQAWNIDGELQADAYPQVVRNDDLSRFIL443 (443)
T 1OFH_A401RLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL443 (443)
T ss_pred401HHHHHHHCCCCCCCCCEEEEEHHHHHHHHHHHHHHHHHHHHCC443 (443)
T ss_dssp401HHSHHHHHHGGGCTTCEEEECHHHHHHHTCSSSSCCCCTTSCC443 (443)


No 6
> 3HWS_A    ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 4i81_A* 4i4l_A* 4i34_A* 4i5o_A 4i63_A 4i9k_A 3hte_A     Alignment in PIR format
MAC score = 184.12	Identity = 0.23

Download partial structureDownload full-length structure
Q ss_pred1CCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCC-CCCCCCCCCCEEEECCCCCHHHHHHHHHHHHCCCCEEE80 (447)
Q d20181120_41SEMTPREIVSEKDQFICGDADAKRSVDIGNRNRWRNMQDQK-PLRCEVTPKNILMIGPTGVEKTEIARWLAKLYIAPFIK80 (447)
T 3HWS_A1ALPTPHEIRNHLDDYVIGQEQAKKVLAVAVYNHYKRLRNGDTSNGVELGKSNILLIGPTGSGKTLLAETLARLLDVPFTM80 (447)
T ss_pred1CCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCEEE80 (447)
T ss_dssp1CCCCHHHHHHHHHHHCCSCHHHHHHHHHHHHHHHHHHHTTSCSSSCCCCCCCEEEECCTTSSHHHHHHHHHHHTTCCEEE80 (447)
Q ss_pred81EEECCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC160 (447)
Q d20181120_481STATMFTWVGYVGKEVDPLIRDLTWWAGKGHLLHLPANPWNVSMINEKHMDVQHSEPCRHNKNWHGFESSGLFCRFHYPH160 (447)
T 3HWS_A81ADATTLTEAGYVGEDVENIIQKLLQKCDYDVQKAQ----RGIVYIDQIDK-ISR-------------KSDN-------PS160 (447)
T ss_pred81EEHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHCC----CCEEEEECCCC-CCC-------------CCCC-------CC160 (447)
T ss_dssp81EEHHHHTTCHHHHHHHTHHHHHHHHHTTTCHHHHH----HCEEEEECHHH-HCC-------------CSSC-------CU160 (447)
Q ss_pred161CCCCCHHHHHH-HHHHHCCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH240 (447)
Q d20181120_4161WAHPVEMFSVR-RHCELEKGREKDPNYELNYQAWVFLCCNQSYYYRLATCHVPGQPMPDQGFSIITVPEAHKSDINSNFG240 (447)
T 3HWS_A161ITRDVSGEGVQQALLKLIEGT--V--AAVPP---QG--------GRKH-PQQEFLQVDTSKILFI---CG------GAFA240 (447)
T ss_pred161CCCCCCHHHHHHHHHHHHHCC--C--CCCCC---CC--------CCCC-CCCCCEEEECCCCEEE---EE------CCHH240 (447)
T ss_dssp161UUCHHHHHHHHHHHHHHHHCC--U--UUUUU---UU--------UUUU-UUUUCCCCCTTSSEEE---EE------ECCT240 (447)
Q ss_pred241HHHHHHHHHHHC--CCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCHHHHHHHHHHHHCCCC320 (447)
Q d20181120_4241ETIRARDAVHQN--GSRFDREIDKGCGTGECSIADCSKTGVQRDVLPLVERINVSTKPGMVKMCHILFIVFWMFLVARES320 (447)
T 3HWS_A241GLDKVISHRVETGSGIGFGATVKAKS--D---KASE------G---ELLA---------QVE--PEDLIKF---------320 (447)
T ss_pred241HHHHHHHHHHHHHCCCCCCCCCCCCC--C---CHHH------H---HHHH---------HCC--HHHHHCC---------320 (447)
T ss_dssp241THHHHHHHHHCCCCUUUUUUUUUUUU--C---CSCH------H---HHHH---------TCC--HHHHHHH---------320 (447)
Q ss_pred321CCCCCCCCCCCCEEECCCCCHHHHHHHHHCCCCHHHHHHHHHHHHCCCEEEECHHHHHHHHHHHHHHCCCCCCCCHHHHH400 (447)
Q d20181120_4321DLIPPLGQFLPIRVFLTALSACDFERILTMPHRSMRENYKALMQQEGVNIMFTTDAVWKIAEAAFYVCPKTENIGARRLH400 (447)
T 3HWS_A321GLIPEFIGRLPVVATLNELSEEALIQILKEPKNALTKQYQALFNLEGVDLEFRDEALDAIAKKAMA-----RKTGARGLR400 (447)
T ss_pred321CCCHHHHHCCCCEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECHHHHHHHHHHHHH-----CCCCCHHHH400 (447)
T ss_dssp321TCCHHHHTTCCEEEECCCCCHHHHHHHHHSSTTCHHHHHHHHHHTTTCEEEECHHHHHHHHHHHHH-----TTCTTTTHH400 (447)
Q ss_pred401HHHHHHHHHHCCCCCCCCCCEEEECHHHHHHHHHHHHHCCCCCCCCC447 (447)
Q d20181120_4401VVMERLMWKISFSASCKNGQAWNIDGELQADAYPQVVRNDDLSRFIL447 (447)
T 3HWS_A401SIVEAALLDTMYDLPSMEDVEKVVIDESVIDGQSEPLLIYGKPEAQQ447 (447)
T ss_pred401HHHHHHHHHHHHCCCCCCCCEEEEEEHHHHHCCCCCCCCCCCCHHHH447 (447)
T ss_dssp401HHHHHHHHHHHHSTTTCCCSEEEECHHHHTTCCSCCEEECUUUUUUU447 (447)


No 7
> 3HTE_A        Alignment in PIR format
MAC score = 180.3	Identity = 0.22

Download partial structureDownload full-length structure
Q ss_pred1CCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCC-CCCCCCCEEEECCCCCHHHHHHHHHHHHCCCCEEE80 (445)
Q d20181120_41SEMTPREIVSEKDQFICGDADAKRSVDIGNRNRWRNMQDQKPLR-CEVTPKNILMIGPTGVEKTEIARWLAKLYIAPFIK80 (445)
T 3HTE_A1ALPTPHEIRNHLDDYVIGQEQAKKVLAVAVYNHYKRLRNGDTSNGVELGKSNILLIGPTGSGKTLLAETLARLLDVPFTM80 (445)
T ss_pred1CCCCHHHHHHHHHHCEECHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCEEE80 (445)
T ss_dssp1CCCCHHHHHHHHHHHSCSCHHHHHHHHHHHHHHHHHHHHCSSCSSSCCCCCCEEEECCTTSSHHHHHHHHHHTTTCCEEE80 (445)
Q ss_pred81EEECCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC160 (445)
Q d20181120_481STATMFTWVGYVGKEVDPLIRDLTWWAGKGHLLHLPANPWNVSMINEKHMDVQHSEPCRHNKNWHGFESSGLFCRFHYPH160 (445)
T 3HTE_A81ADATTLTEAGYVGEDVENIIQKLLQKCDYDVQKAQR----GIVYIDQIDK-ISR------------KSDNPSIT------160 (445)
T ss_pred81EEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHH-HHH------------CCCCCCHH------160 (445)
T ss_dssp81EEHHHHCUCCTHHHHHHHHHHHHHHHHTTCHHHHHH----CEEEEECGGG-GCC------------UUUUUUUU------160 (445)
Q ss_pred161CCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHH240 (445)
Q d20181120_4161WAHPVEMFSVRRHCELEKGREKDPNYELNYQAWVFLCCNQSYYYRLATCHVPGQPMPDQGFSIITVPEAHKSDINSNFGE240 (445)
T 3HTE_A161-RDVSGEGVQQALLKLIEGTV----AAVPP---QG--------GRKH-PQQEFLQVDTSKILFIC---GG--AFA-GLDK240 (445)
T ss_pred161-HHHHHHHHHHHCHHHHCEEE----EECCC---CC--------CCCC-CCCCCCCCCHHHHHHHH---HH--HHC-CHHH240 (445)
T ss_dssp161-UUCHHHHHHHHHHHHHHCCU----UUUUU---UU--------UUUU-UUUCCCCCCSSSSEEEE---EE--CCT-THHH240 (445)
Q ss_pred241HHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCC320 (445)
Q d20181120_4241TIRARDAVHQNGSRFDREIDKGCGTGECSIADCSKTGVQRDVLPLVERINVSTKPGMVKMCHILFIVFWMFLVARESDLI320 (445)
T 3HTE_A241VISHR-VETGSGIGFGATVKAKSDK-----AS--EG----E---LLA---------QVEPED--LIKFG---------LI320 (445)
T ss_pred241HHHHH-HHCCCCCCCCCCCCCHHHH-----CC--HH----H---HHH---------HCCHHH--HHHHC---------CC320 (445)
T ss_dssp241HHHHH-HHHSCCUUUUUUUUUUUCC-----CC--SH----H---HHT---------TCCHHH--HHHHT---------CC320 (445)
Q ss_pred321CCCCCCCCCEEECCCCCHHHHHHHHHCCCCHHHHHHHHHHHHCCCEEEECHHHHHHHHHHHHHHCCCCCCCCHHHHHHHH400 (445)
Q d20181120_4321PPLGQFLPIRVFLTALSACDFERILTMPHRSMRENYKALMQQEGVNIMFTTDAVWKIAEAAFYVCPKTENIGARRLHVVM400 (445)
T 3HTE_A321PEFIGRLPVVATLNELSEEALIQILKEPKNALTKQYQALFNLEGVDLEFRDEALDAIAKKAMA-----RKTGARGLRSIV400 (445)
T ss_pred321HHHHCCCCEEEECCCCCHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEEECHHHHHHHHHHHHH-----CCCCHHHHHHHH400 (445)
T ss_dssp321HHHHTTCCEEEECCCCCHHHHHHHHHSSTTCHHHHHHHHHHTTTCEEEECHHHHHHHHHHHHH-----HTCTTTHHHHHH400 (445)
Q ss_pred401HHHHHHHCCCCCCCCCCEEEECHHHHHHHHHHHH-HCCCCCCCCC445 (445)
Q d20181120_4401ERLMWKISFSASCKNGQAWNIDGELQADAYPQVV-RNDDLSRFIL445 (445)
T 3HTE_A401EAALLDTMYDLPSMEDVEKVVIDESVIDGQSKPLLIYGKPEAQQA445 (445)
T ss_pred401HHHHHHHHCCCCCCCCCCEEEECHHHHCCHHCHHHHCCCCHHHHH445 (445)
T ss_dssp401HHHHHHHHHHSTTSCCSEEEECHHHHTSCCSCCEEECCCUUUUUU445 (445)


No 8
> 1UM8_A    ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20     Alignment in PIR format
MAC score = 173.43	Identity = 0.23

Download partial structureDownload full-length structure
Q ss_pred1CCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCC-----CC-----------CCCCCCCCEEEECCCCCHHHH80 (462)
Q d20181120_41SEMTPREIVSEKDQFICGDADAKRSVDIGNRNRWRNMQDQK-----PL-----------RCEVTPKNILMIGPTGVEKTE80 (462)
T 1UM8_A1YIPAPKELKAVLDNYVIGQEQAKKVFSVAVYNHYKRLSFKEKLKKQDNQDSNVELEHLEEVELSKSNILLIGPTGSGKTL80 (462)
T ss_pred1CCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCCCEEEECCCCCCHHH80 (462)
T ss_dssp1CCCCHHHHHHHHHTTCCSCHHHHHHHHHHHHHHHHHHHHHHHHHHHCSHHHHHHHHHHHHTTCCCCCEEEECCTTSSHHH80 (462)
Q ss_pred81HHHHHHHHCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC160 (462)
Q d20181120_481IARWLAKLYIAPFIKSTATMFTWVGYVGKEVDPLIRDLTWWAGKGHLLHLPANPWNVSMINEKHMDVQHSEPCRHNKNWH160 (462)
T 1UM8_A81MAQTLAKHLDIPIAISDATSLTEAGYVGEDVENILTRLLQASDWNVQKAQ----KGIVFIDE---IDKIS----------160 (462)
T ss_pred81HHHHHHHHHCCCEEEEEHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHCC----CCEEEEEC---CCCCC----------160 (462)
T ss_dssp81HHHHHHHHTTCCEEEEEGGGCCUUUUUUUUCTHHHHHHHHHTTTCHHHHT----TSEEEEET---GGGCU----------160 (462)
Q ss_pred161CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCC240 (462)
Q d20181120_4161GFESSGLFCRFHYPHWAHPVEMFSVRRHCELEKGREKDPNYELNYQAWVFLCCNQSYYYRLATCHVPGQPMPDQGFSIIT240 (462)
T 1UM8_A161RLSENRSITRD------VSGEGV-QQALLKIVEGSL----VNI----PPKG-------GRK---------HPEGNFIQID240 (462)
T ss_pred161CCCCCCCCCCC------CCHHHH-HHHHHHHHHCCC----CCC----CCCC-------CCC---------CCCCCEEEEE240 (462)
T ss_dssp161UUUUUUUUUUU------UUCHHH-HHHHHHHHHCCE----ECU----UUUU-------UUU---------UUUUUUUCEE240 (462)
Q ss_pred241CCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCC---CCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCH320 (462)
Q d20181120_4241VPEAHKSDINSNFGETIRARDAVHQNGSRFDREIDKGCGTGEC---SIADCSKTGVQRDVLPLVERINVSTKPGMVKMCH320 (462)
T 1UM8_A241TSDILFICA-GAFDGLA---E-------IIKKR-----TTQNVLGFTQEKMSKK----EQEAILH---------LVQT-H320 (462)
T ss_pred241CCCEEEEEC-CCCCCHH---H-------HHHHH-----HHHCCCCCCCCCCCHH----HHHHHHH---------HHCH-H320 (462)
T ss_dssp241CTTCEEEEE-ECCTTHH---H-------HTTTS-----CSSCCCSCCCSSCCTT----TTTTSGG---------GCCH-H320 (462)
Q ss_pred321HHHHHHHHHHHCCCCCCCCCCCCCCCCEEECCCCCHHHHHHHHHCCCCHHHHHHHHHHHHCCCEEEECHHHHHHHHHHHH400 (462)
Q d20181120_4321ILFIVFWMFLVARESDLIPPLGQFLPIRVFLTALSACDFERILTMPHRSMRENYKALMQQEGVNIMFTTDAVWKIAEAAF400 (462)
T 1UM8_A321DL----------VTYGLIPELIGRLPVLSTLDSISLEAMVDILQKPKNALIKQYQQLFKMDEVDLIFEEEAIKEIAQLAL400 (462)
T ss_pred321HH----------HHCCCCHHHHCCCCCEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEECCHHHHHHHHHHHH400 (462)
T ss_dssp321HH----------HHTTCCHHHHTTCCEEEECCCCCHHHHHHHHHSSTTCHHHHHHHHHHTTTCEEEECHHHHHHHHHHHH400 (462)
Q ss_pred401HHCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCEEEECHHHHHHHHHHHHHCCCCCCCCC462 (462)
Q d20181120_4401YVCPKTENIGARRLHVVMERLMWKISFSASCKNGQAWNIDGELQADAYPQVVRNDDLSRFIL462 (462)
T 1UM8_A401E-----RKTGARGLRAIIEDFCLDIMFDLPKLKGSEVRITKDCVLKQAEPLIIAKTHSKILP462 (462)
T ss_pred401H-----HCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCEEECCCCCCCCC462 (462)
T ss_dssp401H-----TTCTGGGHHHHHHHHHHHHHHTGGGGTTSEEEECHHHHTTSSCCEEECUUUUUUUU462 (462)


No 9
> 2QZ4_A    Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens}     Alignment in PIR format
MAC score = 82.27	Identity = 0.14

Download partial structureDownload full-length structure
Q ss_pred1HHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCC--CCCCCCCCEEEECCCCCHHHHHHHHHHHHCCCCEEEEEECCCC80 (436)
Q d20181120_41VSEKDQFICGDADAKRSVDIGNRNRWRNMQDQKPL--RCEVTPKNILMIGPTGVEKTEIARWLAKLYIAPFIKSTATMFT80 (436)
T 2QZ4_A1MGVSFKDVAGMHEAKLEVREFVD----YLKSPERFLQLGAKVPKGALLLGPPGCGKTLLAKAVATEAQVPFLAMAGAEFV80 (436)
T ss_pred1CCCCHHHHCCHHHHHHHHHHHHH----HHHCHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEECHHHHH80 (436)
T ss_dssp1CCCCTTSSCSCHHHHHHHHHHHH----HHHCCCUUUUUUCCCCCEEEEESCTTSSHHHHHHHHHHHHTCCEEEEETTTTS80 (436)
Q ss_pred81CCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH160 (436)
Q d20181120_481WVGYVGKEVDPLIRDLTWWAGKGHLLHLPANPWNVSMINEKHMDVQHSEPCRHNKNWHGFESSGLFCRFHYPHWAHPVEM160 (436)
T 2QZ4_A81EVI--GGLGAARVRSLFKEARA----------------------------------------------------------160 (436)
T ss_pred81HHC--CCHHHHHHHHHHHHHHH----------------------------------------------------------160 (436)
T ss_dssp81SSS--TTHHHHHHHHHHHHHHH----------------------------------------------------------160 (436)
Q ss_pred161HHHHHHHHHCCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH240 (436)
Q d20181120_4161FSVRRHCELEKGREKDPNYELNYQAWVFLCCNQSYYYRLATCHVPGQPMPDQGFSIITVPEAHKSDINSNFGETIRARDA240 (436)
T 2QZ4_A161--------------RAPCIVY-IDEIDAVG------KKR-------S-TTMSGFSNTE--------EEQTLNQLLVEMDG240 (436)
T ss_pred161--------------CCCEEEE-EECHHHHH------HCC-------C-CCCCCCCCHH--------HHHHHHHHHHHHHC240 (436)
T ss_dssp161--------------TCSEEEE-EECCUUUU------UUU-------U-UUUUUUUUUU--------UCHHHHHHHHHHHT240 (436)
Q ss_pred241HHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCC320 (436)
Q d20181120_4241VHQNGSRFDREIDKGCGTGECSIADCSKTGVQRDVLPLVERINVSTKPGMVKMCHILFIVFWMFLVARESDLIPPLGQFL320 (436)
T 2QZ4_A241MGTTDHVIVLASTNR---A-----DILD-----------------------------------GALMRP--------GRL320 (436)
T ss_pred241CCCCCCEEEEEECCC---C-----HHCC-----------------------------------HHHHCC--------CCC320 (436)
T ss_dssp241CCTTCCEEEEEEESC---G-----GGGG-----------------------------------SGGGST--------TSC320 (436)
Q ss_pred321CCEEECCCCCHHHHHHHHHCCCCHHHHHHHHHHHHCCCEEEECHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHH400 (436)
Q d20181120_4321PIRVFLTALSACDFERILTMPHRSMRENYKALMQQEGVNIMFTTDAVWKIAEAAFYVCPKTENIGARRLHVVMERLMWKI400 (436)
T 2QZ4_A321DRHVFIDLPTLQERREIF-----------EQHLKSLKLTQSS-TF-------YSQRLAELTPGFSGADIANICNEAALHA400 (436)
T ss_pred321CEEEEECCCCHHHHHHHH-----------HHHHHHCCCCCCH-HH-------HHHHHHHHCCCCCHHHHHHHHHHHHHHH400 (436)
T ss_dssp321CEEEECCSCCHHHHHHHH-----------HHHHHHTTCCBTH-HH-------HHHHHHHTCTTCCHHHHHHHHHHHHTCU400 (436)
Q ss_pred401CCCCCCCCCCEEEECHHHHHHHHHHHHHCCCCCCCC436 (436)
Q d20181120_4401SFSASCKNGQAWNIDGELQADAYPQVVRNDDLSRFI436 (436)
T 2QZ4_A401AREG---HTSVHTLNFEYAVERVLAGTAKKSKILSK436 (436)
T ss_pred401HHHC---CCCCCHHHHHHHHHHHCCCCCCHHHHCCC436 (436)
T ss_dssp401UUUU---UUUCCBCCHHHHHHHHHHHHHCCUUUUUU436 (436)


No 10
> 3SYK_A        Alignment in PIR format
MAC score = 80.84	Identity = 0.15

Download partial structureDownload full-length structure
Q ss_pred1CCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCC-CCCCCCCCCCEEEECCCCCHHHHHHHHHHHHCCCC---80 (461)
Q d20181120_41SEMTPREIVSEKDQFICGDADAKRSVDIGNRNRWRNMQDQK-PLRCEVTPKNILMIGPTGVEKTEIARWLAKLYIAP---80 (461)
T 3SYK_A1EGSGAKEVLEELDRELIGLKPVKDRIRETAALLLVERARQKLGLAHETPTLHMSFTGNPGTGKTTVALKMAGLLHRLGYV80 (461)
T ss_pred1HHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCC80 (461)
T ss_dssp1HHTTHHHHHHHHHHHSCSCHHHHHHHHHHHHHHHHHHHHHHTTCCSSCCCCEEEEESCSSSSHHHHHHHHHHHHHHTTSS80 (461)
Q ss_pred81----EEEEEECCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC160 (461)
Q d20181120_481----FIKSTATMFTWVGYVGKEVDPLIRDLTWWAGKGHLLHLPANPWNVSMINEKHMDVQHSEPCRHNKNWHGFESSGLF160 (461)
T 3SYK_A81RKGHLVSVTRDDLV--GQYIGHTAPKTKEVLKRAM---------------------------------------------160 (461)
T ss_pred81CCCCEEEEEHHHHH--HHHCHHHHHHHHHHHHHCC---------------------------------------------160 (461)
T ss_dssp81SSCCEEEECGGGTC--CSSTTCHHHHHHHHHHHHT---------------------------------------------160 (461)
Q ss_pred161CCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC240 (461)
Q d20181120_4161CRFHYPHWAHPVEMFSVRRHCELEKGREKDPNYELNYQAWVFLCCNQSYYYRLATCHVPGQPMPDQGFSIITVPEAHKSD240 (461)
T 3SYK_A161--------------------------------------GGVLFIDE-AYY--L---YRP--DN-----------------240 (461)
T ss_pred161--------------------------------------CCEEEEEC-HHH--H---CCC--CC-----------------240 (461)
T ss_dssp161--------------------------------------TSEEEEET-GGG--G---CCC--CU-----------------240 (461)
Q ss_pred241CCCCHHHHHHHHHHH-HHCC--CEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCHHHHHHHHH320 (461)
Q d20181120_4241INSNFGETIRARDAV-HQNG--SRFDREIDKGCGTGECSIADCSKTGVQRDVLPLVERINVSTKPGMVKMCHILFIVFWM320 (461)
T 3SYK_A241ERDYGQEAIEILLQVMENNRDDLVVILAGYA----------------------------------------DRMENF---320 (461)
T ss_pred241CCCHHHHHHHHHHHHHCCCCCCEEEEEECCC----------------------------------------CHHHHH---320 (461)
T ss_dssp241UUCCHHHHHHHHHHHHHHCTTTCEEEEEECH----------------------------------------HHHHHH---320 (461)
Q ss_pred321HHHCCCCCCCCCCCCCCCCEEECCCCCHHHHHHHHHCCCCHHHHHHHHHHHHCCCEEEECHHHHHHHHHHHHHHCCCCCC400 (461)
Q d20181120_4321FLVARESDLIPPLGQFLPIRVFLTALSACDFERILTMPHRSMRENYKALMQQEGVNIMFTTDAVWKIAEAAFYVCPKTEN400 (461)
T 3SYK_A321FQ------SNPGFRSRIAHHIEFPDYSDEELFE-----------IAGHMLDDQNYQ--MTPEAETALRAYIGLRR-NQPH400 (461)
T ss_pred321HH------CCCCCCCCCCEEEECCCCCHHHHHH-----------HHHHHHHCCCCC--CCHHHHHHHHHHHHHHC-CCCC400 (461)
T ss_dssp321HH------HSTTHHHHEEEEEECCCCCHHHHHH-----------HHHHHHHHTTCE--ECHHHHHHHHHHHHHHT-TSSS400 (461)
Q ss_pred401CC-HHHHHHHHHHHHHHHCCCC------CCCCCCEEEECHHHHHHHHHHHHHCCCCCCCCC461 (461)
Q d20181120_4401IG-ARRLHVVMERLMWKISFSA------SCKNGQAWNIDGELQADAYPQVVRNDDLSRFIL461 (461)
T 3SYK_A401FANARSIRNALDRARLRQANRLFTASSGPLDARALSTIAEEDIRASR--VFKGGLDSERRA461 (461)
T ss_pred401CCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHCCHHHHHHHH--HHCCCCCCHHHH461 (461)
T ss_dssp401CCHHHHHHHHHHHHHHHHHHHHHHCUUUCEEHHHHHEECTHHHHTSH--HHHCCUUUUUUU461 (461)