TreeThreader - Results

  Job information

Job ID: d20181112
#Proteins: 4
Protein ID: d20181112_4
Fasta ID: seq4
Submission time: 2018-11-12 10:54:03 +0800
Finished time: 2019-02-17 21:21:51 +0800
Identical Job(s): NULL

  Alignments

1
50
100
150
200
250
300
316

  Build multi-template model (choose up to 5 templates)

Building multi-template model...

  Top 10 hits

Query:
Job ID  : d20181112_4
Length : 316
Sequence: GTTKHSKLLILGHYPADYTASVYIARANLQYQMKSGKQKEGQLTAAEEVENWPSDSNDLTHPCLMDWMHEHATKFDTEIL SDFGNLVFLQNRFYRMNGDNGEYTSDALIIATGAKARYRRQSARNAGETMHYNHTQLSKTYWDYVDDRQNVFFAPFVALD QMMQLLAGFAHPPKKIYASTCSNCCVNTWFHYCHLVQKTPEVSVLYVGCNNGPADVHPAHSMIENERWCWFRDTKVPTRP VPTCHSPNTAIFEPQLEYEIGNIKVQSGIHGDATQTSIPGVFKAGDVMDHGYRQEMTSCGTGWMAALDAYRRLDGE

No Hit MAC Score Identity Cols Query HMM Template HMM

  Pairwise Query-Template Alignment