TreeThreader - Results

  Job information

Job ID: d20181011
#Proteins: 4
Protein ID: d20181011_2
Fasta ID: seq2
Submission time: 2018-10-11 10:54:03 +0800
Finished time: 2019-02-17 20:36:06 +0800
Identical Job(s): NULL

  Alignments

1
50
100
150
178
1G2P_A 1G2P_A 1ZN8_A 1ZN8_A 2DY0_A 2DY0_A 1L1Q_A 1L1Q_A 1MZV_A 1MZV_A 1QB8_A 1QB8_A 2FXV_A 2FXV_A 1Y0B_A 1Y0B_A 1O57_A 1O57_A 1P4A_A 1P4A_A

  Build multi-template model (choose up to 5 templates)

                   
Download full-length structure

  Top 10 hits

Query:
Job ID  : d20181011_2
Length : 178
Sequence: MPIAYCWQELKLRLHKYSNFPSEGILFEDFLNIFRNPGRDEKLIDLNNLDLGETFKEVCISGIVGLESCGFLAGGQLALH LGEGKVPEMFAGKLPGGCFKAQYEKEYGRDLFMIAKNAIPIGSNFRIVDDIIATAGEAAAYGNVVEQLHANTLEYNKVME MEELKGRSKNNAPVFSLK

No Hit MAC Score Identity Cols Query HMM Template HMM
11G2P_A155.460.711781-1781-178
21ZN8_A132.830.351762-1781-177
32DY0_A132.590.31741-1789-188
41L1Q_A123.730.291723-1781-179
51MZV_A112.990.241741-17814-204
61QB8_A112.560.241741-17813-203
72FXV_A108.440.21693-1781-182
81Y0B_A107.630.181711-1782-193
91O57_A103.610.191721-17875-266
101P4A_A96.290.191721-17875-268

  Pairwise Query-Template Alignment

No 1
> 1G2P_A        Alignment in PIR format
MAC score = 155.46	Identity = 0.71

Download partial structureDownload full-length structure
Q ss_pred1CCHHHHHHHHHHCCCCCCCCCCCCCCEECCCCCCCCCCCCHHHHHHCHHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHH80 (178)
Q d20181011_21MPIAYCWQELKLRLHKYSNFPSEGILFEDFLNIFRNPGRDEKLIDLNNLDLGETFKEVCISGIVGLESCGFLAGGQLALH80 (178)
T 1G2P_A1MPIASYAQELKLALHQYPNFPSEGILFEDFLPIFRNPGLFQKLIDAFKLHLEEAFPEVKIDYIVGLESRGFLFGPTLALA80 (178)
T ss_pred1CCHHHHHHHHHHHHHCCCCCCCCCCEEEECHHHHCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHH80 (178)
T ss_dssp1UUUUCHHHHHHHHCEEETTCSSTTCCEEECHHHHHSHHHHHHHHHHHHHHHHHHCTTSCCCEEEEETTTHHHHHHHHHHH80 (178)
Q ss_pred81HCCCCEEEECCCCCCCCEEEEEEEEECCCEEEEEECCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCEEEEEEEEEE160 (178)
Q d20181011_281LGEGKVPEMFAGKLPGGCFKAQYEKEYGRDLFMIAKNAIPIGSNFRIVDDIIATAGEAAAYGNVVEQLHANTLEYNKVME160 (178)
T 1G2P_A81LGVGFVPVRKAGKLPGECFKATYEKEYGSDLFEIQKNAIPAGSNVIIVDDIIATGGSAAAAGELVEQLEANLLEYNFVME160 (178)
T ss_pred81HCCCEEEEECCCCCCCCEEEEEEEECCCEEEEEEECCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEEEEEE160 (178)
T ss_dssp81HTCEEEEEEETTCSCSSEEEEEECUUUUCEEEEEETTSSCTTCEEEEEEEEESSCHHHHHHHHHHHHTTCEEEEEEEEEE160 (178)
Q ss_pred161CCCCCCCCCCCCCEEECC178 (178)
Q d20181011_2161MEELKGRSKNNAPVFSLK178 (178)
T 1G2P_A161LDFLKGRSKLNAPVFTLL178 (178)
T ss_pred161CCCCCHHHHCCCCEEEEE178 (178)
T ss_dssp161CGGGCGGGGCCSCEEECC178 (178)


No 2
> 1ZN8_A    APRT, adenine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: AMP; 1.76A {Homo sapiens} SCOP: c.61.1.1 PDB: 1ore_A* 1zn7_A* 1zn9_A*     Alignment in PIR format
MAC score = 132.83	Identity = 0.35

Download partial structureDownload full-length structure
Q ss_pred1CHHHHHHHHHHCCCCCCCCCCCCCCEECCCCCCCCCCCCHHHHHHCHHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHHH80 (178)
Q d20181011_21PIAYCWQELKLRLHKYSNFPSEGILFEDFLNIFRNPGRDEKLIDLNNLDLGETFKEVCISGIVGLESCGFLAGGQLALHL80 (178)
T 1ZN8_A1MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKAT-HGGRIDYIAGLDSRGFLFGPSLAQEL80 (178)
T ss_pred1CCCHHHHHHHHHHHCCCCCCCCCCEEEEHHHHHCCHHHHHHHHHHHHHHHHHH-CCCCCCEEEEECCCCHHHHHHHHHHH80 (178)
T ss_dssp1UUCHHHHHHHTTCEEEETCSSTTCEEEECHHHHHSHHHHHHHHHHHHHHHHHH-HTTCCCEEEEETTTHHHHHHHHHHHH80 (178)
Q ss_pred81CCCCEEEECCCCCCCCEEEEEEEEECCCEEEEEECCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCEEEEEEEEEEC160 (178)
Q d20181011_281GEGKVPEMFAGKLPGGCFKAQYEKEYGRDLFMIAKNAIPIGSNFRIVDDIIATAGEAAAYGNVVEQLHANTLEYNKVMEM160 (178)
T 1ZN8_A81GLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVEL160 (178)
T ss_pred81CCCEEEEEECCCCCCCEECHHHHHHCCCCEEEEECCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEEEEEEC160 (178)
T ss_dssp81TCEEEEEEETTCCCSSEEEEEEEETTEEEEEEEETTSSCTTCEEEEEEEEESSSHHHHHHHHHHHHTTCEEEEEEEEEEE160 (178)
Q ss_pred161CCCCCCCCC-CCCEEECC178 (178)
Q d20181011_2161EELKGRSKN-NAPVFSLK178 (178)
T 1ZN8_A161TSLKGREKLAPVPFFSLL178 (178)
T ss_pred161CCCCHHHHHCCCCEEEEE178 (178)
T ss_dssp161GGGCHHHHHTTSCEEEEE178 (178)


No 3
> 2DY0_A    APRT, adenine phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.25A {Escherichia coli K12} PDB: 4mb6_A     Alignment in PIR format
MAC score = 132.59	Identity = 0.3

Download partial structureDownload full-length structure
Q ss_pred1CCHHHHHHHHHHCCCCCCCCCCCCCCEECCCCCCCCCCCCHHHHHHCHHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHH80 (184)
Q d20181011_21MPIAYCWQELKLRLHKYSNFPSEGILFEDFLNIFRNPGRDEKLIDLNNLDLGETFKEVCISGIVGLESCGFLAGGQLALH80 (184)
T 2DY0_A1TATAQQLEYLKNSIKSIQDYPKPGILFRDVTSLLEDPKAYALSIDLL----VERYKNAGITKVVGTEARGFLFGAPVALG80 (184)
T ss_pred1CCCHHHHHHHHHHHHCCCCCCCCCCCEEHHHHHHCCHHHHHHHHHHH----HHHHHHCCCCEEEEECCCCHHHHHHHHHH80 (184)
T ss_dssp1CCCHHHHHHHHHHSEEETTCSSTTCCEEETHHHHHCHHHHHHHHHHH----HHHHTTTTCCEEEEETTHHHHHHHHHHHH80 (184)
Q ss_pred81HCCCCEEEECCCCCCCCEEEEEEEEECCCEEEEEECCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCEEEEEEEEEE160 (184)
Q d20181011_281LGEGKVPEMFAGKLPGGCFKAQYEKEYGRDLFMIAKNAIPIGSNFRIVDDIIATAGEAAAYGNVVEQLHANTLEYNKVME160 (184)
T 2DY0_A81LGVGFVPVRKPGKLPRETISETYDLEYGTDQLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFIIN160 (184)
T ss_pred81HCCCEEEEEECCCCCCCEECHHHHHHCCCCEEEEECCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEEEEEE160 (184)
T ss_dssp81HTCEEEEEBSTTCCCSCEEEEEEEETTEEEEEEEEGGGCCTTCEEEEEEEEESSCHHHHHHHHHHHHTTCEEEEEEEEEE160 (184)
Q ss_pred161CCCCCCCCCC---CC---CEEECC184 (184)
Q d20181011_2161MEELKGRSKN---NA---PVFSLK184 (184)
T 2DY0_A161LFDLGGEQRLEKQGITSYSLVPFP184 (184)
T ss_pred161CCCCCHHHHHHHCCCCEEEEEEEC184 (184)
T ss_dssp161EGGGCHHHHHHTTTCEEEEEEEEC184 (184)


No 4
> 1L1Q_A    Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, cataly transferase; HET: 9DA; 1.85A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1l1r_A*     Alignment in PIR format
MAC score = 123.73	Identity = 0.29

Download partial structureDownload full-length structure
Q ss_pred1HHHHHHHHHHCCCCCCCCCCCCCCEECCCCCCCCCCCCHHHHHHCHHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHHHC80 (183)
Q d20181011_21IAYCWQELKLRLHKYSNFPSEGILFEDFLNIFRNPGRDEKLIDLNNLDLGETFKEVCISGIVGLESCGFLAGGQLALHLG80 (183)
T 1L1Q_A1MTMSVADAHALIKTIPDFPTKGIAFKDLSDILSTP----AALDAVRKEVTAHYKDVPITKVVGIESRGFILGGIVANSLG80 (183)
T ss_pred1CCCHHHHHHHHHHCCCCCCCCCCEEEEHHHHHCCH----HHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHC80 (183)
T ss_dssp1UCCCHHHHHHTCEEETTCSSTTCCEEECHHHHTCH----HHHHHHHHHHHHHTTTSCCCEEEEESGGGHHHHHHHHHHHT80 (183)
Q ss_pred81CCCEEEECCCCCCCCEEEEEEEEECCC-EEEEEECCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHCC--EEEEEEEEE160 (183)
Q d20181011_281EGKVPEMFAGKLPGGCFKAQYEKEYGR-DLFMIAKNAIPIGSNFRIVDDIIATAGEAAAYGNVVEQLHA--NTLEYNKVM160 (183)
T 1L1Q_A81VGFVALRKAGKLPGDVCKCTFDMEYQKGVTIEVQKRQLGPHDVVLLHDDVLATGGTLLAAIELCETAGVKPENIYINVLY160 (183)
T ss_pred81CCEEEEEECCCCCCCEEEEEEEHHHCCCEEEEEECCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEEEEEEE160 (183)
T ss_dssp81CEEEEEEETTSSCSSEEEEEEEETTEEEEEEEEEGGGCCTTCCEEEEEEEESSSHHHHHHHHHHHHTTCCGGGEEEEEEE160 (183)
Q ss_pred161ECCCCCCCCCC----CCCEEECC183 (183)
Q d20181011_2161EMEELKGRSKN----NAPVFSLK183 (183)
T 1L1Q_A161EIEALKGREKVGQKCTRLFSVIR183 (183)
T ss_pred161ECCCCCHHHHCCCCCEEEEEEEH183 (183)
T ss_dssp161ECGGGCHHHHHTTTCCCEEEEEE183 (183)


No 5
> 1MZV_A        Alignment in PIR format
MAC score = 112.99	Identity = 0.24

Download partial structureDownload full-length structure
Q ss_pred1CCHHHHHHHHHHCCCCCCC--CCCCCCCEECCCCCCCCCCCCHHHHHHCHHHHHHHHCC--CCCCEEEECCCCCCCCHHH80 (195)
Q d20181011_21MPIAYCWQELKLRLHKYSN--FPSEGILFEDFLNIFRNPGRDEKLIDLNNLDLGETFKE--VCISGIVGLESCGFLAGGQ80 (195)
T 1MZV_A1EDSHSLSQLLKKNYRWYSPIFSPRNVPRFADVSSITESPETLKAI----RDFLVERYRTMSPAPTHILGFDARGFLFGPM80 (195)
T ss_pred1CCHHHHHHHHHHHHHEECCCCCCCCCEEEEECHHHHCCHHHHHHH----HHHHHHHHHHCCCCCCEEEEECCCCCHHHHH80 (195)
T ss_dssp1CTTSHHHHHHHHHCEEECGGGSSSSSSCEEETHHHHTCHHHHHHH----HHHHHHHHHSCSSCCSEEEEETTGGGGTHHH80 (195)
Q ss_pred81HHHHHCCCCEEEECCCCCCCCEEEEEEEEECCC----EEEEEECCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCEE160 (195)
Q d20181011_281LALHLGEGKVPEMFAGKLPGGCFKAQYEKEYGR----DLFMIAKNAIPIGSNFRIVDDIIATAGEAAAYGNVVEQLHANT160 (195)
T 1MZV_A81IAVELGIPFVLMRKADKNAGLLIRSEPYEKEYKEAAPEVMTIRHGSIGKNSRVVLIDDVLATGGTALSGLQLVEASGAEV160 (195)
T ss_pred81HHHHHCCCEEEEECCCCCCCCCEEEEEEEEECCCCEEEEEEEECCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEE160 (195)
T ss_dssp81HHHHHTCCEEEEBCGGGCCSSEEECCCCCCCTTCCCCCCCEEETTSSCTTCEEEEEEEEESSSHHHHHHHHHHHHTTCEE160 (195)
Q ss_pred161EEEEEEEECCCCCCCCC---------CCCCEEECC195 (195)
Q d20181011_2161LEYNKVMEMEELKGRSK---------NNAPVFSLK195 (195)
T 1MZV_A161VEMVSILTIPFLKAAERIHSTAGGRYKNVRFIGLL195 (195)
T ss_pred161EEEEEEEECCCCCHHHHHHHCCCCEEEEEEEECCC195 (195)
T ss_dssp161EEEEEEEECGGGCHHHHHHHGGGGTTTTCCEEEEE195 (195)


No 6
> 1QB8_A        Alignment in PIR format
MAC score = 112.56	Identity = 0.24

Download partial structureDownload full-length structure
Q ss_pred1CCHHHHHHHHHHCCCCCC--CCCCCCCCEECCCCCCCCCCCCHHHHHHCHHHHHHHHC--CCCCCEEEECCCCCCCCHHH80 (195)
Q d20181011_21MPIAYCWQELKLRLHKYS--NFPSEGILFEDFLNIFRNPGRDEKLIDLNNLDLGETFK--EVCISGIVGLESCGFLAGGQ80 (195)
T 1QB8_A1DDSHALSQLLKKSYRWYSPVFSPRNVPRFADVSSITESPETLKA----IRDFLVQRYRAMSPAPTHILGFDARGFLFGPM80 (195)
T ss_pred1HHHHHHHHHHHHHCCEECCCCCCCCCCEEEECHHHHCCHHHHHH----HHHHHHHHHHHCCCCCCEEEEECCCCCHHHHH80 (195)
T ss_dssp1CTTSHHHHHHHHHCCEECGGGSSSCSSCEECTHHHHTCHHHHHH----HHHHHHHHHHHCSSCCCEEEEETTGGGGTHHH80 (195)
Q ss_pred81HHHHHCCCCEEEECCCCCCCCEEEEEEEEECC----CEEEEEECCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCEE160 (195)
Q d20181011_281LALHLGEGKVPEMFAGKLPGGCFKAQYEKEYG----RDLFMIAKNAIPIGSNFRIVDDIIATAGEAAAYGNVVEQLHANT160 (195)
T 1QB8_A81IAVELEIPFVLMRKADKNAGLLIRSEPYEKEYKEAAPEVMTIRYGSIGKGSRVVLIDDVLATGGTALSGLQLVEASDAVV160 (195)
T ss_pred81HHHHHCCCEEEEECCCCCCCCEEEEEEEEEEECCCCEEEEEEECCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEE160 (195)
T ss_dssp81HHHHHTCCEEEEBCTTTCCSSEEECCCCCCCSSCCCCCCCEEETTSSCTTCEEEEEEEEESSCHHHHHHHHHHHHTTCEE160 (195)
Q ss_pred161EEEEEEEECCCCCCCCC--------C-CCCEEECC195 (195)
Q d20181011_2161LEYNKVMEMEELKGRSK--------N-NAPVFSLK195 (195)
T 1QB8_A161VEMVSILSIPFLKAAEKIHSTANSRYKDIKFISLL195 (195)
T ss_pred161EEEEEEEECCCCCHHHHHHHCCCCEEEEEEEEEEC195 (195)
T ss_dssp161EEEEEEEECGGGCHHHHHHHHHHHTTTTCCEEEEE195 (195)


No 7
> 2FXV_A        Alignment in PIR format
MAC score = 108.44	Identity = 0.2

Download partial structureDownload full-length structure
Q ss_pred1HHHHHHHHHHCCCCCCCCCCCCCCEECCCCCCCCCCCCHHHHHHCHHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHHHC80 (189)
Q d20181011_21IAYCWQELKLRLHKYSNFPSEGILFEDFLNIFRNPGRDEKLIDLNNLDLGETFKEVCISGIVGLESCGFLAGGQLALHLG80 (189)
T 2FXV_A1MEALKRKIEEEGVVLSD---QVLKVDSFLN----HQIDPLLMQRIGDEFASRFAKDGITKIVTIESSGIAPAVMTGLKLG80 (189)
T ss_pred1CHHHHHHCCCCCEECCC---CCEEEEECHH----CCCCHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHC80 (189)
T ss_dssp1CHHHHHHHHHHCEECSS---SCEECIIIII----SEECHHHHHHHHHHHHHHTTTSCCCEEEEETTTTHHHHHHHHHHHT80 (189)
Q ss_pred81CCCEEEECCCCCC--CCEEEEEEEEEC--CCEEEEEECCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCEEEEEEEE160 (189)
Q d20181011_281EGKVPEMFAGKLP--GGCFKAQYEKEY--GRDLFMIAKNAIPIGSNFRIVDDIIATAGEAAAYGNVVEQLHANTLEYNKV160 (189)
T 2FXV_A81VPVVFARKHKSLTLTDNLLTASVYSFTKQTESQIAVSGTHLSDQDHVLIIDDFLANGQAAHGLVSIVKQAGASIAGIGIV160 (189)
T ss_pred81CCEEEEECCCCCCCCCCEEEEEEEEECCCCEEEEEEEHHCCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCEEEEEEEE160 (189)
T ss_dssp81CCEEEEEEECCSSCCSSEEEEEEECTTTCCEEEEEEEGGGCCTTCEEEEEEEEESSSHHHHHHHHHHHHTTCEEEEEEEE160 (189)
Q ss_pred161EECCCCCCCCC---CCC------CEEECC189 (189)
Q d20181011_2161MEMEELKGRSK---NNA------PVFSLK189 (189)
T 2FXV_A161IEKSFQPGRDELVKLGYRVESLARIQSLE189 (189)
T ss_pred161EECCCCCHHHHHHHCCCCEEEEEEEEEEC189 (189)
T ss_dssp161EEETTSTHHHHHGGGTCCEEEEEEEEECG189 (189)


No 8
> 1Y0B_A    Xanthine phosphoribosyltransferase; purine metabolism, STRU genomics, PSI, protein structure initative, midwest center structural genomics; HET: G4P; 1.80A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 2fxv_A*     Alignment in PIR format
MAC score = 107.63	Identity = 0.18

Download partial structureDownload full-length structure
Q ss_pred1CCHHHHHHHHHHCCCCCCCCCCCCCCEECCCCCCCCCCCCHHHHHHCHHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHH80 (199)
Q d20181011_21MPIAYCWQELKLRLHKYSNFPSEGILFEDFLNIFRNPGRDEKLIDLNNLDLGETFKEVCISGIVGLESCGFLAGGQLALH80 (199)
T 1Y0B_A1NAMEALKRKIEEEGVVLS---DQVLKVDSFLN----HQIDPLLMQRIGDEFASRFAKDGITKIVTIESSGIAPAVMTGLK80 (199)
T ss_pred1HHHHHHHHHHHHCCCCCC---CCEEEEHHHHH----CCCCHHHHHHHHHHHHHHHCCCCCCEEEEECCCCHHHHHHHHHH80 (199)
T ss_dssp1CHHHHHHHHHHHHCEEET---TTEEECTTTTS----SEECHHHHHHHHHHHHHHTTTTTCCEEEEETTTTHHHHHHHHHH80 (199)
Q ss_pred81HCCCCEEEECCCCCC----CCEEEEEEEEECCCEEEEEECCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCEEEEEE160 (199)
Q d20181011_281LGEGKVPEMFAGKLP----GGCFKAQYEKEYGRDLFMIAKNAIPIGSNFRIVDDIIATAGEAAAYGNVVEQLHANTLEYN160 (199)
T 1Y0B_A81LGVPVVFARKHKSLTLTDNLLTASVYSFTKQTESQIAVSGTHLSDQDHVLIIDDFLANGQAAHGLVSIVKQAGASIAGIG160 (199)
T ss_pred81HCCCEEEEEECCCCCCCCCEEEEEEEEECCCCCEEEEEECCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEE160 (199)
T ss_dssp81HTCCEEEEBSSCCSSCCSSEEEEEEEETTTTEEEEEEEEGGGCCTTCEEEEEEEEESSCHHHHHHHHHHHHTTCEEEEEE160 (199)
Q ss_pred161EEEECCCCCCCCC---CC--------------CCEEECC199 (199)
Q d20181011_2161KVMEMEELKGRSK---NN--------------APVFSLK199 (199)
T 1Y0B_A161IVIEKSFQPGRDELVKLGYRVESLARIQSLEEGKVSFVQ199 (199)
T ss_pred161EEEECCCCCHHHHHHHCCCCEEEEEEECCCCCCCEEEEE199 (199)
T ss_dssp161EEEEETTSTHHHHHHHTTCCEEEEEEEEECTTTCCEECC199 (199)


No 9
> 1O57_A    PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} SCOP: a.4.5.40 c.61.1.1 PDB: 1p4a_A*     Alignment in PIR format
MAC score = 103.61	Identity = 0.19

Download partial structureDownload full-length structure
Q ss_pred1CCH---HHHHHHHHHCCCCCCCCCCCCCCEECCCCCCCCCCCCHHHHHHCHHHHHHHHCCCCCCEEEECCCCCCCCHHHH80 (198)
Q d20181011_21MPI---AYCWQELKLRLHKYSNFPSEGILFEDFLNIFRNPGRDEKLIDLNNLDLGETFKEVCISGIVGLESCGFLAGGQL80 (198)
T 1O57_A1MKQAEAEEFVQTLGQSLAN-PERILPGG-YVYLTDILGKPSVLSKVGKLFASVFA----EREIDVVMTVATKGIPLAYAA80 (198)
T ss_pred1CCHHHHHHHHHHHHHHHHH-CCCCCCCC-EEEEHHHCCCHHHHHHHHHHHHHHHH----CCCCCEEEEECCCCHHHHHHH80 (198)
T ss_dssp1CCHHHHHHHHHHHHHHHTC-GGGEETTT-EECCTTTTTCHHHHHHHHHHHHHHTT----TSCCSEEEEETTTTHHHHHHH80 (198)
Q ss_pred81HHHHCCCCEEEECCCCC-CCCEEEEEEEEECC--CEEEEEECCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCEEEE160 (198)
Q d20181011_281ALHLGEGKVPEMFAGKL-PGGCFKAQYEKEYG--RDLFMIAKNAIPIGSNFRIVDDIIATAGEAAAYGNVVEQLHANTLE160 (198)
T 1O57_A81ASYLNVPVVIVRKDNKVTEGSTVSINYVSGSSNRIQTMSLAKRSMKTGSNVLIIDDFMKAGGTINGMINLLDEFNANVAG160 (198)
T ss_pred81HHHHCCCEEEEEEECCCCCCCCEEEEEEECCCCCEEEEEECCHHCCCCCEEEEEEEEECCCHHHHHHHHHHHHCCCEEEE160 (198)
T ss_dssp81HHHHTCCEEEEBCCUUUUUCCEEEEEEECSSCCSEEEEEEEGGGSCTTCEEEEEEEEESSSHHHHHHHHHTGGGTCEEEE160 (198)
Q ss_pred161EEEEEECCCCCCCCC---------C-----CCCEEECC198 (198)
Q d20181011_2161YNKVMEMEELKGRSK---------N-----NAPVFSLK198 (198)
T 1O57_A161IGVLVEAEGVDERLVDEYMSLLTLSTINMKEKSIEIQN198 (198)
T ss_pred161EEEEEECCCHHHHHCCCEEEEEEECCCCCCCCCEECCH198 (198)
T ss_dssp161EEEEEEESSCTTSCCSCCEEEEEEECCCSSSSCCEEEE198 (198)


No 10
> 1P4A_A        Alignment in PIR format
MAC score = 96.29	Identity = 0.19

Download partial structureDownload full-length structure
Q ss_pred1CCH---HHHHHHHHHCCCCCCCCCCCCCCEECCCCCCCCCCCCHHHHHHCHHHHHHHHCCCCCCEEEECCCCCCCCHHHH80 (200)
Q d20181011_21MPI---AYCWQELKLRLHKYSNFPSEGILFEDFLNIFRNPGRDEKLIDLNNLDLGETFKEVCISGIVGLESCGFLAGGQL80 (200)
T 1P4A_A1MKQAEAEEFVQTLGQSLAN-PERILPGG-YVYLTDILGKPSVLSKVGKLFASVFA----EREIDVVMTVATKGIPLAYAA80 (200)
T ss_pred1CCHHHHHHHHHHHHHHHCC-CCEECCCC-EEECCHHHCCHHHHHHHHHHHHHHHH----CCCCCEEEEECCCCHHHHHHH80 (200)
T ss_dssp1CCHHHHHHHHHHHHHHHHC-GGGBCSSS-CBCCTTGGGCHHHHHHHHHHHHHHST----TSCCSEEEEESSTTHHHHHHH80 (200)
Q ss_pred81HHHHCCCCEEEECCCCC-CCCEEEEEEEEEC--CCEEEEEECCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCEEEE160 (200)
Q d20181011_281ALHLGEGKVPEMFAGKL-PGGCFKAQYEKEY--GRDLFMIAKNAIPIGSNFRIVDDIIATAGEAAAYGNVVEQLHANTLE160 (200)
T 1P4A_A81ASYLNVPVVIVRKDNKVTEGSTVSINYVSGSSNRIQTMSLAKRSMKTGSNVLIIDDFMKAGGTINGMINLLDEFNANVAG160 (200)
T ss_pred81HHHHCCCEEEEECCCCCCCCCEEEEEEECCCCCCEEEEEEECCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEEEE160 (200)
T ss_dssp81HHHHTCCEEEEBCCUUUUUUCEEEEEEECTTCSSEEEEEEEGGGSCTTCEEEEEEEEESSSHHHHHHHHHHHHTTCEEEE160 (200)
Q ss_pred161EEEEEECCCCCCCCC-----------C----CC-CEEECC200 (200)
Q d20181011_2161YNKVMEMEELKGRSK-----------N----NA-PVFSLK200 (200)
T 1P4A_A161IGVLVEAEGVDERLVDEYMSLLTLSTINMKEKSIEIQNGN200 (200)
T ss_pred161EEEEEECCCCCCHHHHCCCCEEEEEEEEECCCCEEEECCC200 (200)
T ss_dssp161EEEEEEESCCSSCCSSCCEEEEEECCSCSSSSCCCEEECS200 (200)