TreeThreader - Results

  Job information

Job ID: d20181008
#Proteins: 4
Protein ID: d20181008_1
Fasta ID: seq1
Submission time: 2018-10-08 10:54:02 +0800
Finished time: 2019-02-17 20:16:37 +0800
Identical Job(s): NULL

  Alignments

1
50
100
150
200
220
1YF2_A 1YF2_A 3OKG_B 3OKG_B 1YDX_A 1YDX_A 2Y7H_A 2Y7H_A 2A7K_A 2A7K_A 2GZA_A 2GZA_A 3OTH_A 3OTH_A 2QH9_A 2QH9_A 3MEM_A 3MEM_A 1I9G_A 1I9G_A

  Build multi-template model (choose up to 5 templates)

                   
Download full-length structure

  Top 10 hits

Query:
Job ID  : d20181008_1
Length : 220
Sequence: SFYKPENFKKMKIGEIPPDDEIVYLKYVCKKIKAGGTPKDPVFEYEKNGSIPFVKIEVITNSNKYLAVRKMKETAEGLDN NYAWIVHKNSMLSTMYGSISELAINAIEVATNAAISGICPPDNILHSYRLYYMLHENYNDQSKLRMQTTQKNLNAQIVDS VKINLSTLKEQCQIGKILLDRDEGIEIIEKSINKREIIKQGLMHKLITKHIGHSRFEKSE

No Hit MAC Score Identity Cols Query HMM Template HMM
11YF2_A146.50.712201-2201-332
23OKG_B71.060.132131-2205-319
31YDX_A70.890.161981-22018-308
42Y7H_A69.890.1620811-2201-225
52A7K_A40.590.112047-2191-250
62GZA_A39.960.092181-22031-347
73OTH_A39.190.122051-216130-412
82QH9_A38.620.11735-2161-184
93MEM_A37.930.11921-2201-240
101I9G_A37.480.082111-2205-266

  Pairwise Query-Template Alignment

No 1
> 1YF2_A    Type I restriction-modification enzyme, S subunit; structura genomics, PSI, protein structure initiative; 2.40A {Methanocaldococcus jannaschii} SCOP: d.287.1.2 d.287.1.2     Alignment in PIR format
MAC score = 146.5	Identity = 0.71

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCCCCCCEEEHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEEECEECCCCEEEEECHHHCCHHHHHC80 (332)
Q d20181008_11SFYKPENFKKMKIGEIPPDDEIVYLKYVCKKIKAGGTPKDPVFEYEKNGSIPFVKIEVITNSNKYLAVRKMKETAEGLDN80 (332)
T 1YF2_A1MFYKEENFKKTEIGEIPEDWEIVELKDVCKKIKAGGTPKTSVEEYYKNGTIPFVKIEDITNSNKYLTNTKIKITEEGLNN80 (332)
T ss_pred1CCCCCCCCCCCCCCCCCCCCEEEEHHHHHCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCEEECCCCEEECHHHHHH80 (332)
T ss_dssp1CEECCCCCBCCSSSSCBSSCCCEEHHHHEEEEEECCCCCTTCGGGTTTCCEEEECHHHHHTSSSEECCCSEEECHHHHHT80 (332)
Q ss_pred81CCCEEEECCCEEEEECCCCCHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHCHHHHHHHHHCCCCCCCCHHCCCC160 (332)
Q d20181008_181NYAWIVHKNSMLSTMYGSISELAINAIEVATNAAISGICPPDNILHSYRLYYMLHENYNDQSKLRMQTTQKNLNAQIVDS160 (332)
T 1YF2_A81SNAWIVPKNSVLFAMYGSIGETAINKIEVATNQAILGIIPKDNILESEFLYYILAKNKNYYSKLGMQTTQKNLNAQIVKS160 (332)
T ss_pred81CHHCCCCCCCEEEEEECCCCEEEEECCCCEECCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHC160 (332)
T ss_dssp81SSCCCBCTTCEEEECSSSTTCEEEESSCBEECSSEEEEEECTTTCCHHHHHHHHHHTHHHHHCCSSSSSCCCCCHHHHHT160 (332)
Q ss_pred161EEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC------------------------C240 (332)
Q d20181008_1161VKINLSTLKEQCQIGKILLDRDEGIEIIEKSINKREIIKQGLMHKLITKHIGHSR------------------------F240 (332)
T 1YF2_A161FKIPLPPLEEQKQIAKILTKIDEGIEIIEKSINKLERIKKGLMHKLLTKGIGHSRFKKSEIGEIPEDWEVFEIKDIFEVK240 (332)
T ss_pred161CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHCCCCCCCEEECHHHHEEEC240 (332)
T ss_dssp161CEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCSSCCCEECCTTSSEETTCEEEEHHHHEEEE240 (332)
Q ss_pred241C-------------------------------------------------------------------------------320 (332)
Q d20181008_1241E-------------------------------------------------------------------------------320 (332)
T 1YF2_A241TGTTPSTKKSEYWENGEINWITPLDLSRLNEKIYIGSSERKVTKIALEKCNLNLIPKGSIIISTRAPVGYVAVLTVESTF320 (332)
T ss_pred241CCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCEEEECCCCHHHHHHHHHCCCEECCCCCEEEEEECCCCCEEEECCCCCC320 (332)
T ss_dssp241ECCCCCTTCGGGTTTCCEEEECHHHHHTTTTCSEECCCSSEECHHHHHHTTCCCBCTTCEEEECSSSTTCEEEESSCBEE320 (332)
Q ss_pred321---------CCC332 (332)
Q d20181008_1321---------KSE332 (332)
T 1YF2_A321NQGCKGLFQKNN332 (332)
T ss_pred321CCCCEEEEECCC332 (332)
T ss_dssp321CTTEEEEEESCT332 (332)


No 2
> 3OKG_B        Alignment in PIR format
MAC score = 71.06	Identity = 0.13

Download partial structureDownload full-length structure
Q ss_pred1CCCC--CCCCCCCCCCCCCCCCCEEEHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEEECEECCCCEEEEECHHHCCHHHH80 (322)
Q d20181008_11SFYK--PENFKKMKIGEIPPDDEIVYLKYVCKKIKAGGTPKDPVFEYEKNGSIPFVKIEVITNSNKYLAVRKMKETAEGL80 (322)
T 3OKG_B1HHHHSMDIEFMTEGPYKLPPGWRWVRLGEVCLPTERRDPTKN------PSTYFVYVDISAIDSTVGKIVS-PKEILGQHA80 (322)
T ss_pred1HHHHCCCCCCCCCCCCCCCCCCEEEECHHHEEECCCCCCCCC------CCCCCCEEEEEEEECCCCEECC-CEEEECHHC80 (322)
T ss_dssp1UUUUUUUUUUCCSCSSCCCTTCEEEEGGGGBCCCCBCCGGGS------TTCEEEEECGGGEETTTTEECC-CEEEEGGGC80 (322)
Q ss_pred81HCCCCEEEECCCEEEEECCC-CCHHHHHHHH---HHCCCCCEEEECCCCCCHHHHHHHHHH--HCHHHHHHHHH-CCCCC160 (322)
Q d20181008_181DNNYAWIVHKNSMLSTMYGS-ISELAINAIE---VATNAAISGICPPDNILHSYRLYYMLH--ENYNDQSKLRM-QTTQK160 (322)
T 3OKG_B81PSRARKVIRSGDVIFATTRPYLKNIALVPPDLDGQICSTGFCVIRANREFAEPEFLFHLCRSDFITNQLTASKMRGTSYP160 (322)
T ss_pred81CHHCCEECCCCCEEEEECCCCCCCEEEECCCCCCCEEECCEEEEECCHHHCCHHHHHHHHCCHHHHHHHHHHHCCCCCCC160 (322)
T ss_dssp81CTTEEEECCTTCEEEESSSGGGCCEEECCGGGTTCEEETTEEEECBCTTTCCHHHHHHHHTSHHHHTTCGGGSSCCTTCC160 (322)
Q ss_pred161CCCHHCCCCEEEECCCHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHCC------------C----240 (322)
Q d20181008_1161NLNAQIVDSVKINLSTLKEQCQIGKILLDRDEGIEI----IEKSINKREIIKQGLMHKLITKH------------I----240 (322)
T 3OKG_B161AVTDNDVYNTLIPLPPLEEQRRIVAKVEALMERVREVRRLRAEAQKDTELLMQTALAEVFPHPGADLPPGWRWVRLGEVC240 (322)
T ss_pred161CCCHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEHHHHE240 (322)
T ss_dssp161CCCHHHHHTSEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCTTSCCCTTCEEEEHHHHE240 (322)
Q ss_pred241------------CC------------------------------CCCCC-------------------------------320 (322)
Q d20181008_1241------------GH------------------------------SRFEK-------------------------------320 (322)
T 3OKG_B241DIIMGQSPPSSTYNFEGNGLPFFQGKADFGDLHPTPRIWCSAPQKVARPGDVLISVRAPVGSTNVANLACCIGRGLAALR320 (322)
T ss_pred241EECCCCCCCCCCCCCCCCCEEEEEEEEEECCEEECCCCCCCCHHCCCCCCCEEEEECCCCCEEEECCCCEEEECEEEEEE320 (322)
T ss_dssp241EEEECCCCCTTCEESSSSSEEEECSGGGCCSSSCCCCCEESSCCSEECTTCEEEECSSSCCCEEECCSCEEECTTEEEEE320 (322)
Q ss_pred321CC322 (322)
Q d20181008_1321SE322 (322)
T 3OKG_B321PR322 (322)
T ss_pred321EC322 (322)
T ss_dssp321EC322 (322)


No 3
> 1YDX_A    Type I restriction enzyme specificity protein Mg4; type-I HSDS, DNA binding protein; 2.30A {Mycoplasma genitalium} SCOP: d.287.1.2 d.287.1.2     Alignment in PIR format
MAC score = 70.89	Identity = 0.16

Download partial structureDownload full-length structure
Q ss_pred1C-CCCCCCCCCCCCCCCCCCCCEEEHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEEECEECCCCEEEEECHHHCCHHHHH80 (313)
Q d20181008_11S-FYKPENFKKMKIGEIPPDDEIVYLKYVCKKIKAGGTPKDPVFEYEKNGSIPFVKIEVITNSNKYLAVRKMKETAEGLD80 (313)
T 1YDX_A1DDDDKHMTP-KLKL-NNNINWTKRTIDSLFDL-KKGEMLEKEL--ITPEGKYEYFNG--GVKNSGRT------------D80 (313)
T ss_pred1HHHCCCCCC-CCCC-CCCCCCEEEECCCEEEE-ECCCCCCCCE--EECCCCEEEEEE--CCCCCCEE------------E80 (313)
T ss_dssp1UUUUUUCCC-SSCS-SSSCCCEEEEHHHHEEE-EECCCCCGGG--CCTTCSEEEESS--SSSCSCEE------------S80 (313)
Q ss_pred81CCCCEEEECCCEEEEECCCCCHHHHHHHHHHCCCCCEEEECCCC-CCHHHHHHHHHHHCHHHHHHHHHCCCCCCCCHHCC160 (313)
Q d20181008_181NNYAWIVHKNSMLSTMYGSISELAINAIEVATNAAISGICPPDN-ILHSYRLYYMLHENYNDQSKLRMQTTQKNLNAQIV160 (313)
T 1YDX_A81---KFNTFKNTISVIVGGSCGYVRLADKNFFCGQSNCTLNLLDPLELDLKFAYYALKSQQERIEALAFGTTIQNIRISDL160 (313)
T ss_pred81---CCCCCCCCEEEECCCCCEEEEEECCCEEEECCEEEEEECCCCCCCHHHHHHHHHCHHHHHHHHCCCEEEEEECHHHH160 (313)
T ss_dssp81---CCCBCSSCEEEECBSSTTCEEECSSCBEECTTEEEEEESCTTTSCHHHHHHHHHTTHHHHHTTCBCSSSCBCCHHHH160 (313)
Q ss_pred161CCEEEECC-CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC--------------------------240 (313)
Q d20181008_1161DSVKINLS-TLKEQCQIGKILLDRDEGIEIIEKSINKREIIKQGLMHKLITKHI--------------------------240 (313)
T 1YDX_A161KELEIPFTSNKNEQHAIANTLSVFDERLENLASLIEINRKLRDEYAHKLFSLDEAFLSHWKLEALQSQMHEITLGEIFNF240 (313)
T ss_pred161CEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCCCHHHHEEE240 (313)
T ss_dssp161HHCEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHHTTCTHHHHHCEEEEGGGTEEE240 (313)
Q ss_pred241-CCC-----------------------------CC----------------------------------CCCC313 (313)
Q d20181008_1241-GHS-----------------------------RF----------------------------------EKSE313 (313)
T 1YDX_A241KSGKYLKSEERLEEGKFPYYGAGIDNTGFVAEPNTEKDTISIISNGYSLGNIRYHEIPWFNGTGSIALEPMNN313 (313)
T ss_pred241CCCCCCCCCCEEECCCEEEEECCCCCCCCCCCCCCCCCEEEEECCCCCCEEEEEECCCCEECCCEEEEEECCH313 (313)
T ss_dssp241EECCCCCGGGCBSSCSEEEESSSSSCSSEESSCSBCSSEEEEECSSTTTTCEEEESSCBEECTTEEEEEESST313 (313)


No 4
> 2Y7H_A        Alignment in PIR format
MAC score = 69.89	Identity = 0.16

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCEEEHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEEECEECCCCEEEEECHHHCCHHHHHCCCCEEEECCC80 (227)
Q d20181008_11MKIGEIPPDDEIVYLKYVCKKIKAGGTPKDPVFEYEKNGSIPFVKIEVITNSNKYLAVRKMKETAEGLDNNYAWIVHKNS80 (227)
T 2Y7H_A1MSAGKLPEGWVIAPVSTVTTLIRGVTYKKEQAINYLKDDYLPLIRANNIQNGK-F-DTTDLVFVPKNLVKESQKISPEDI80 (227)
T ss_pred1CCCCCCCCCCEEEECHHEEEEECCCCCCCCCCCCCCCCCCEEEEEEEECCCCE-E-ECCCCEECCHHHCCCCEEECCCCE80 (227)
T ss_dssp1CCSSCCCSSCEEEEHHHHCSEEECCCCCCSSCHHHHSSCCSEECCHHHHHSSS-B-CCCSEECCHHHHHHSSCCCBCSSC80 (227)
Q ss_pred81EEEEECCC---CCHHHHHHH-HHHCCCCCEEEECCCCCCHHHHHHHHHHH-C-HHHHHHHHHCCCCCCCCHHCCCCEEEE160 (227)
Q d20181008_181MLSTMYGS---ISELAINAI-EVATNAAISGICPPDNILHSYRLYYMLHE-N-YNDQSKLRMQTTQKNLNAQIVDSVKIN160 (227)
T 2Y7H_A81VIAMSSGSKSVVGKSAHQHLPFECSFGAFCGVLRPEKLIFSGFIAHFTKSSLYRNKISSLSAGANINNIKPASFDLINIP160 (227)
T ss_pred81EEEECCCCCCEEEEEEEECCCCCEEECCEEEEECCCCCHHHHHHHHHHHCHHHHHHHHHHCCCCCCCEECHHHHHHCCCC160 (227)
T ss_dssp81EEEESSSSSSSCCEEEEBCSSSBBCCSSEEEEECCTTTSCHHHHHHHHHSHHHHHHHHTTCSCSSCSSCCHHHHHHCEEE160 (227)
Q ss_pred161CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC--CC---------CCCCCCC227 (227)
Q d20181008_1161LSTLKEQCQIGKILLDRDEGIEIIEKSINKREIIKQGLMHKLITKHI--GH---------SRFEKSE227 (227)
T 2Y7H_A161IPPLAEQKIIAEKLDTLLAQVDSTKARFEQIPQILKRFRQAVLGGAVNGKLTEKWRNFEPQHSVFKK227 (227)
T ss_pred161CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHCCCCCCCCHHEE227 (227)
T ss_dssp161ECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCSCSCEECCSSSSEESSCEEEE227 (227)


No 5
> 2A7K_A    CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A*     Alignment in PIR format
MAC score = 40.59	Identity = 0.11

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCEEEHHHHHCCCCCCCCCC-------CCCCCCCCCCCCCEEEECEECCC----CEEEEECHHHCCH80 (259)
Q d20181008_11NFKKMKIGEIPPDDEIVYLKYVCKKIKAGGTPK-------DPVFEYEKNGSIPFVKIEVITNS----NKYLAVRKMKETA80 (259)
T 2A7K_A1MVFEENS----DEVRVITLDHPNKH---NPFSRTLETSVKDALARANADDSVRAVVVYGGAERSFSAGGDFNEVKQLSRS80 (259)
T ss_pred1CEEEEEE----CCEEEEEECCCCCC---CCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCHHHHHHCCCH80 (259)
T ss_dssp1CEEEEEE----TTEEEEEECCSSTT---CBCCHHHHHHHHHHHHHHHHCTTCCEEEEECCTTSCSBCBSCHHHHHTCUCH80 (259)
Q ss_pred81H----HHHC---CCCEEEECC-CEEEEECCCCCHHHHHHH---HHHC-CCCCEEEECC-CC-CCHHHHHHHHHHHC-HHH160 (259)
Q d20181008_181E----GLDN---NYAWIVHKN-SMLSTMYGSISELAINAI---EVAT-NAAISGICPP-DN-ILHSYRLYYMLHEN-YND160 (259)
T 2A7K_A81EDIEEWIDRVIDLYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCSVGAAILGFTHGFST160 (259)
T ss_pred81HHHHHHHHHHHHHHHHHHCCCCCEEEEECCEEHHHHHHHHHHCCEEEECCCCEEECHHHHCCCCCCCHHHHHHHHHCHHH160 (259)
T ss_dssp81HHHHHHHHHHHHHHHHHHTCCSCEEEEECSEEETHHHHHHTTSSEEEEETTCEEECCGGGGTCCCHHHHHHHHHHHCHHH160 (259)
Q ss_pred161HHHHHHCCCCCCCCHHCCC---CEEEECCCHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC240 (259)
Q d20181008_1161QSKLRMQTTQKNLNAQIVD---SVKINLSTLKEQCQIGKILLDR-----DEGIEIIEKSINKREIIKQGLMHKLITKHIG240 (259)
T 2A7K_A161MQEIIYQC--QSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFINTKRAVNKPFIHLLEQTRDASKAVHKA240 (259)
T ss_pred161HHHHHHHC--CCCCHHHHHHCCCCCEECCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHH240 (259)
T ss_dssp161HHHHHHHC--CCBCHHHHHHHTCCSEEECHHHHHHHHHHHHHHHHTSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCU240 (259)
Q ss_pred241---------CC-CC--CCC259 (259)
Q d20181008_1241---------HS-RF--EKS259 (259)
T 2A7K_A241AFQARDAQGHFKNVLGKKY259 (259)
T ss_pred241HHCCHHHHHHHHHHHCCCC259 (259)
T ss_dssp241UUUUUUUUUUUUUUUUUUU259 (259)


No 6
> 2GZA_A    Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis}     Alignment in PIR format
MAC score = 39.96	Identity = 0.09

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCC-------CCCCCCCEEEH--------HHHHCCCC--CCCCCC----CCCCCCCCCCCCCEEEECEE80 (319)
Q d20181008_11SFYKPENFKKMKIG-------EIPPDDEIVYL--------KYVCKKIK--AGGTPK----DPVFEYEKNGSIPFVKIEVI80 (319)
T 2GZA_A1PWLDDPQITEVCVNRPGEVFCERASAWEYYAVPNLDYEHLISLGTATARFVDQDISDSRPVLSAILPMGERIQIVRPPAC80 (319)
T ss_pred1HHHCCCCCEEEEECCCCEEEEEECCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCEEEEEECCCC80 (319)
T ss_dssp1HHHSCTTEEEEEESSTTEEEEEETTEEEEEECTTCCHHHHHHHHHHHHHHTTCCCSSSSCEEEEECTTSCEEEEECTTTB80 (319)
Q ss_pred81CCCCEEEEECHHHC---C------------------------HHHHHC----CC----CEEEECC-CEEEEECCCCCH--160 (319)
Q d20181008_181TNSNKYLAVRKMKE---T------------------------AEGLDN----NY----AWIVHKN-SMLSTMYGSISE--160 (319)
T 2GZA_A81EHGTISVTIRKPSFTRRTLEDYAQQGFFKHVRPMSKSLTPFEQELLALKEAGDYMSFLRRAVQLERVIVVAGETGSGKTT160 (319)
T ss_pred81CCCCCEEEEECCCCCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHH160 (319)
T ss_dssp81CTTCCEEEEECCCCCCCCHHHHHHTTTTSCCCCSCSCCCHHHHHHHHHHHHTCHHHHHHHHHHTTCCEEEEESSSSCHHH160 (319)
Q ss_pred161HHHHHHHHHCC-CCCEEEECCCCC-----------C-------------HHHHHHHHHHHC-HHHHHHHHHCCC----CC240 (319)
Q d20181008_1161LAINAIEVATN-AAISGICPPDNI-----------L-------------HSYRLYYMLHEN-YNDQSKLRMQTT----QK240 (319)
T 2GZA_A161LMKALMQEIPFDQRLITIEDVPELFLPDHPNHVHLFYPSEAKEEENAPVTAATLLRSCLRMKPTRILLAELRGGEAYDFI240 (319)
T ss_pred161HHHHHHCCCCCCCCEEEECCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCEEEECCCCHHHHHHHH240 (319)
T ss_dssp161HHHHHHTTSCTTSCEEEEESSSCCCCTTCSSEEEEECCUUUUUUUUUUCCHHHHHHHHTTSCCSEEEESCCCSTHHHHHH240 (319)
Q ss_pred241CCCHH--CCCCEEEECCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-------CCCCCCCCC319 (319)
Q d20181008_1241NLNAQ--IVDSVKINLST-LKEQCQIGKILLDRDEGIEIIEKSINKREIIKQGLMHKLITKHI-------GHSRFEKSE319 (319)
T 2GZA_A241NVAASGHGGSITSCHAGSCELTFERLALMVLQNRQGRQLPYEIIRRLLYLVVDVV--VHVHNGVHDGTGRHISEVWYDP319 (319)
T ss_pred241HHHCCCCCEEEEEEEHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCCEE--EEEEEEECCCCCEEEEEEEECC319 (319)
T ss_dssp241HHHHTTCCSCEEEEECSSHHHHHHHHHHHHTTSTTGGGSCHHHHHHHHHHHCCEE--EEEECCCSSSCCSEEEEEEECH319 (319)


No 7
> 3OTH_A        Alignment in PIR format
MAC score = 39.19	Identity = 0.12

Download partial structureDownload full-length structure
Q ss_pred1CC---------------CCCCCCCCCCC--CCCCCCCCEEEHHHHHCCC----CCC-CCCCCCCCCCCCCCCCCEEEECE80 (294)
Q d20181008_11SF---------------YKPENFKKMKI--GEIPPDDEIVYLKYVCKKI----KAG-GTPKDPVFEYEKNGSIPFVKIEV80 (294)
T 3OTH_A1RPDLVVQEISNYGAGLAALKAGIPTICHGVGRDTP---DDLTRSIEEEVRGLAQRLGLDLPPGRIDGF---GNPFIDIFP80 (294)
T ss_pred1CCCEEEECCHHHHHHHHHHHHCCCEEEEECCCCCH---HHHHHHHHHHHHHHHHHHCCCCCHHHHHCC---CCCEEECCC80 (294)
T ss_dssp1CCSEEEEETTCHHHHHHHHHHTCCEEEECCSCCCC---SHHHHHHHHHHHHHHHHTTCCCCSSCCGGG---GSCEEECSC80 (294)
Q ss_pred81--E-CC-----CCEEEEECH-HHCC---HHHHHCCCCEEEECCCEEEEECCCC---C-HHHHHHHHHHCC-CCCEEEECC160 (294)
Q d20181008_181--I-TN-----SNKYLAVRK-MKET---AEGLDNNYAWIVHKNSMLSTMYGSI---S-ELAINAIEVATN-AAISGICPP160 (294)
T 3OTH_A81PSLQEPEFRARPRRHELRPVPFAEQGDLPAWLSS----RDTARPLVYLTLGTSSGGTVEVLRAAIDGLAGLDADVLVASG160 (294)
T ss_pred81CCCCCCCCCCCCCEEEECCCCCCCCCCCCHHHHH----CCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCEEEEEEC160 (294)
T ss_dssp81GGGSCHHHHTCTTEEECCCCCCCCCCCCCGGGGG----SCTTSCEEEEECCSSSSSCHHHHHHHHHHHHTSSSEEEEECT160 (294)
Q ss_pred161CC--------------CC---HHHHHHH----HHHH-CHHHHHHHHHC----CC---CC--CCCHHCCCC--EEEEC---240 (294)
Q d20181008_1161DN--------------IL---HSYRLYY----MLHE-NYNDQSKLRMQ----TT---QK--NLNAQIVDS--VKINL---240 (294)
T 3OTH_A161PSLDVSGLGEVPANVRLESWVPQAALLPHVDLVVHHGGSGTTLGALGAGVPQLSFPWAGDSFANAQAVAQAGAGDHLLPD240 (294)
T ss_pred161CCCCCCCCCCCCCCEEEECCCCHHHHHHHCCEEEECCCHHHHHHHHHCCCCEEECCCCCCHHHHHHHHHHCCCEECCCCC240 (294)
T ss_dssp161TTCCCTTTCCCCTTEEEESCCCHHHHGGGCSEEEESCCHHHHHHHHHHTCCEEECCCSTTHHHHHHHHHHTTSEEECCTT240 (294)
Q ss_pred241-CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHCCCCCCCC294 (294)
Q d20181008_1241-STLKEQCQIGKILLDRDEGIEIIEKSINKREII--KQGLMHKLITKHIGHSRF294 (294)
T 3OTH_A241NISPDSVSGAAKRLLAEESYRAGARAVAAEIAAMPGPDEVVRLLPGF-ASRSAG294 (294)
T ss_pred241CCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHH-HHHCCC294 (294)
T ss_dssp241SCSHHHHHHHHHHHHHCHHHHHHHHHHHHHHHTSCCHHHHGGGHHHH-HCUUUU294 (294)


No 8
> 2QH9_A    UPF0215 protein AF_1433; structural genomics, PSI-2, MCSG, PR structure initiative; 1.80A {Archaeoglobus fulgidus}     Alignment in PIR format
MAC score = 38.62	Identity = 0.1

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCCEEEHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEEECEECCCCEEEEECHHHCCH-HHHHC---80 (223)
Q d20181008_11PENFKKMKIGEIPPDDEIVYLKYVCKKIKAGGTPKDPVFEYEKNGSIPFVKIEVITNSNKYLAVRKMKETA-EGLDN---80 (223)
T 2QH9_A1GNAMK---------KWRFLGIDDSF-D-------D-------R--KCCVVGCVTCGGYVEGFLYTEIDIDGLDATDKLIS80 (223)
T ss_pred1CCCCC---------CCEEEEEECCC-C-------C-------C--CEEEEEEEEECCEEEEEEEEEEEECCCCHHHHHHH80 (223)
T ss_dssp1CTTGG---------GSEEEEEEEEE-C-------S-------S--CEEEEEEEEETTEEEEEEEEEECTTCSCHHHHHHH80 (223)
Q ss_pred81-CCCEEEECC-CEEEEECCCCCHHHHHHHHHH---CCCCCEEEECCCCCCHHHHHHHHHHHCHHHHHHHHHCCCCCCCCH160 (223)
Q d20181008_181-NYAWIVHKN-SMLSTMYGSISELAINAIEVA---TNAAISGICPPDNILHSYRLYYMLHENYNDQSKLRMQTTQKNLNA160 (223)
T 2QH9_A81MVRRSKFREQIKCIFLPGITLGGFNLVDIQRVYRETKIPVVVVMRRKPDMEEFDSAMRNLENYELRRKIVEVAG-EIH--160 (223)
T ss_pred81HHHHCCCCCCCEEEEECCEEEEEEEEECHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHCCCHHHHHHHHHHCC-CCE--160 (223)
T ss_dssp81HHTTCTTTTTEEEEEESSSEETTTEECCHHHHHHHHCCCEEEEESSCCCHHHHHHHHTTSTTHHHHHHHHHHTC-CCE--160 (223)
Q ss_pred161HCCCCEEEECC--CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCC223 (223)
Q d20181008_1161QIVDSVKINLS--TLKEQCQIGKILLDRDEGIEIIEKSINKREIIKQGLMHKLITKHIGHSRF223 (223)
T 2QH9_A161RI-GDIYIQTAGLTPSEAEKLVKASLIKGNMPEPVRISHLVASA--------IIHGESRGK-A223 (223)
T ss_pred161EE-CCEEEEECCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHH--------HHCCCCCCC-C223 (223)
T ss_dssp161EE-TTEEEEEESSCHHHHHHHHHHHCSSSSSCHHHHHHHHHHHH--------HHCCUUUUU-U223 (223)


No 9
> 3MEM_A    Putative signal transduction protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.25A {Marinobacter aquaeolei}     Alignment in PIR format
MAC score = 37.93	Identity = 0.1

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCCCCCCEEEHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEEECEECCCCEEEEECH-HHCC-HHHH80 (268)
Q d20181008_11SFYKPENFKKMKIGEIPPDDEIVYLKYVCKKIKAGGTPKDPVFEYEKNGSIPFVKIEVITNSNKYLAVRK-MKET-AEGL80 (268)
T 3MEM_A1GMELPVVVQQ-ALGDNAPGVSFRSVS--------------QID----TGHLLRMVLLSDDQGNLQAICRRNDMLDLEALN80 (268)
T ss_pred1CCCHHHHHHH-HHHCCCCCCCEEEEC--------------CCC----CCCEEEEEEEEECCCEEEEEECCCCEECHHHHH80 (268)
T ss_dssp1UUCCCHHHHH-HHTTSCTTCEEEECC--------------SSC----GGGBEEEEEEEETTEEEEEEEETTSEECHHHHH80 (268)
Q ss_pred81HCCC--------------------------------CEEEEC----CCEEEEECCC---CCHHHHHHHHHHCC-CCCEEE160 (268)
Q d20181008_181DNNY--------------------------------AWIVHK----NSMLSTMYGS---ISELAINAIEVATN-AAISGI160 (268)
T 3MEM_A81KRLGRDLRMMQRREQVRVRQKAGLQELPALPSLTGWPTVVDRRVDELEAVALELGEQDLGLMMPAEDFRQLTAKAARHDF160 (268)
T ss_pred81HHHCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEHHHCCCCCEEEECCCCCEEEEECHHHHHHHHCCCCCCEE160 (268)
T ss_dssp81HHHTCCCEECCHHHHHHHHHHHTCSSCCSCGGGTCCCEEEEHHHHHCSEEEEECSSSSEEEEEEHHHHHHHTTTSEEECC160 (268)
Q ss_pred161ECC-CCC--C--HHHHHHHHHHHCHHHHHHHHHCCCCCCCCHHCCCCEEEECC-CHHHHHHHHHHHHHHHHHHHHHHHHH240 (268)
Q d20181008_1161CPP-DNI--L--HSYRLYYMLHENYNDQSKLRMQTTQKNLNAQIVDSVKINLS-TLKEQCQIGKILLDRDEGIEIIEKSI240 (268)
T 3MEM_A161AVDTANISVNLDNHAADRDQL---HSAIKRF---TGLR--IQQRLEDT-LELPPLPETAQRIIHLRVNPNAVMGDLVDVV240 (268)
T ss_pred161CCCCCCCCCCCCCCCCCHHHH---HHHHHHH---HHHH--HHHHHHHC-CCCCCCCHHHHHHHHHHCCCCCCHHHHHHHH240 (268)
T ss_dssp161EECGGGCCCCSSCGGGHHHHH---HHHHHHH---SCCC--CCSSHHHH-TTCCCCCHHHHHHHHHHHCCSCCHHHHHHHH240 (268)
Q ss_pred241HHHHHHHHHHHHHHHHCCCCCCCCCCCC268 (268)
Q d20181008_1241NKREIIKQGLMHKLITKHIGHSRFEKSE268 (268)
T 3MEM_A241ESDPSLAAQVVSWASSSFYAAAGRVHSV268 (268)
T ss_pred241HHCHHHHHHHHHHHHHHHHCCCCCCCCH268 (268)
T ss_dssp241HHSHHHHHHHHHHHHSTTTGGGCCCCCH268 (268)


No 10
> 1I9G_A    Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13     Alignment in PIR format
MAC score = 37.48	Identity = 0.08

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCC--------CCCCCCCEEEHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEEECEECCCCEEEEEC--H80 (271)
Q d20181008_11SFYKPENFKKMKIG--------EIPPDDEIVYLKYVCKKIKAGGTPKDPVFEYEKNGSIPFVKIEVITNSNKYLAVR--K80 (271)
T 1I9G_A1GPFS-IGERVQLTDAKGRRYTMSLTPGA-EFHTHRGSIAHDAVIGLEQGSVVKSSNGALFLVLRPLLV---DYVMSMPRG80 (271)
T ss_pred1CCCC-CCCEEEEEECCCCEEEEEECCCC-EEECCCCCCCHHHHCCCCCCCEEEECCCCEEEEECCCHH---HHHHHCCCC80 (271)
T ss_dssp1CSCC-TTCEEEEEETTCCEEEEECCTTC-EEEETTEEEEHHHHTTCCTTEEEECSSCCEEEEECCCHH---HHHTTSCSC80 (271)
Q ss_pred81HHC-CHHHHHCCC-CEEEECCCEEEEECCCCCHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHC------HHHHH160 (271)
Q d20181008_181MKE-TAEGLDNNY-AWIVHKNSMLSTMYGSISELAINAIEVATNAAISGICPPDNILHSYRLYYMLHEN------YNDQS160 (271)
T 1I9G_A81PQVIYPKDAAQIVHEGDIFPGARVLEAGAGSGALTLSLLRAVGPAGQVISYEQRADHAEHARRNVSGCYGQPPDNWRLVV160 (271)
T ss_pred81CEEECHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCEEEEE160 (271)
T ss_dssp81SCCCCHHHHHHHHHHTTCCTTCEEEEECCTTSHHHHHHHHHHCTTSEEEEECSCHHHHHHHHHHHHHHHTSCCTTEEEEC160 (271)
Q ss_pred161HHHHCCCCCCCCHHCCCCEEEECCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC---CCCC-----240 (271)
Q d20181008_1161KLRMQTTQKNLNAQIVDSVKINLST-LKEQCQIGKILLDRDEGIEIIEKSINKREIIKQGLMHKLITK---HIGH-----240 (271)
T 1I9G_A161SDLADS---ELPDGSVDRAVLDMLAPWEVLDAVSRLLVAGGVLMVYV-ATVTQLSRIVEALRAKQCWTEPRAWETLQRGW240 (271)
T ss_pred161CCCCCC---CCCCCCEEEEEECCCCHHHHHHHHHHHCCCCCEEEEEE-CCHHHHHHHHHHHHHCCCCCCCEEEEEEEEEE240 (271)
T ss_dssp161SCGGGC---CCCTTCEEEEEEESSCGGGGHHHHHHHEEEEEEEEEEE-SSHHHHHHHHHHHHHHSSBCCCEEECCCCCCE240 (271)
Q ss_pred241------CCCCC------------------CC271 (271)
Q d20181008_1241------SRFEK------------------SE271 (271)
T 1I9G_A241NVVGLAVRPQHSMRGHTAFLVATRRLAPGAV271 (271)
T ss_pred241ECCCCCCCCCCCCCCCCEEEEEEEECCCCCC271 (271)
T ss_dssp241EEETTEEEECSCCCCCSCEEEEEEBCCTTCC271 (271)