TreeThreader - Results

  Job information

Job ID: d20181004
#Proteins: 4
Protein ID: d20181004_2
Fasta ID: seq2
Submission time: 2018-10-04 10:54:02 +0800
Finished time: 2019-02-17 20:14:47 +0800
Identical Job(s): NULL

  Alignments

1
50
100
150
200
250
300
350
400
450
500
550
600
638
1FO4_A 1FO4_A 2E1Q_A 2E1Q_A 3AN1_A 3AN1_A 1N5X_A 1N5X_A 3NRZ_C 3NRZ_C 3SR6_C 3SR6_C 2E3T_A 2E3T_A 2CKJ_A 2CKJ_A 3EUB_C 3EUB_C 1WYG_A 1WYG_A

  Build multi-template model (choose up to 5 templates)

                   
Download full-length structure

  Top 10 hits

Query:
Job ID  : d20181004_2
Length : 638
Sequence: IVTIELAYANKSFEGSELKIEKGDPKKLFMEADNKDSGELWHGGQDKFYLETHCTIARDCGDEGDMELFSRTQNAMKTDS FAAVMCGVPVNRILVRHARMGVKFKGKETRNGLVSVAEMLYAGKVKHDGYCALDRNEDMLIDGGRHPFLARYKVYFMITW TIVILEVDSTINAAVSRDLSHSIMHRRLGDRDNCMKIKNIVETGRLCKIKLSSNMAFRGLGGPRALFTAEAWISFVAVTC SLGDAEGRWWNMAFRGDLTHFNQRLISFSVPRCWDECLWSSQDYARKSMVNKFNLENCWAMRGLCLIDTKFGKSFTVPFG NQMGDLIHLYTTGSVSVSHWGTPMGNGPHTKMVQGASIALRTPIAKIYKLETSTGTGFNSDPTMNSNNHDIYAQAVDEAC QTPLMRVEPAKKKNKDGSKEMWEMAAYQDRVMLSTTGFYQFPPLSYMFETWSGAAFHYWTYGVEWSEAEIDCETDSHKNI PTDWIMDVGSSLNPAIKIDQVEGAFVQGFGHFTLAKLQYSPERSLHPPGPSAYWIPVFGSIPVEFRYSLNKDCPKVIACY ATIGVGTPPLFLGGSVFFAIKDAIIAFRAQHTNNNTKEHFELDSAATPEKINTAMVDKFETLVVTCIPGNCKPWSLRV

No Hit MAC Score Identity Cols Query HMM Template HMM
11FO4_A530.920.716381-638601-1332
22E1Q_A530.640.636381-638602-1333
33AN1_A527.50.616371-638601-1331
41N5X_A523.470.716381-638600-1331
53NRZ_C521.130.716321-63231-756
63SR6_C520.270.716211-62131-745
72E3T_A517.140.616371-638601-1331
82CKJ_A512.980.626381-638605-1333
93EUB_C512.330.716381-63831-762
101WYG_A512.10.66371-638601-1331

  Pairwise Query-Template Alignment

No 1
> 1FO4_A        Alignment in PIR format
MAC score = 530.92	Identity = 0.71

Download partial structureDownload full-length structure
Q ss_pred1C-------------------------------------------------------------------------------80 (732)
Q d20181004_21I-------------------------------------------------------------------------------80 (732)
T 1FO4_A1NELFLRLVTSTRAHAKIKSIDVSEAQKVPGFVCFLSADDIPGSNETGLFNDETVFAKDTVTCVGHIIGAVVADTPEHAER80 (732)
T ss_pred1CCEEEEEEECCCCCEEEEEECHHHHHHCCCEEEEECHHHCCCCCCCCCCCCCCCCCCCEEEECCCEEEEEEECCHHHHHH80 (732)
T ss_dssp1TCEEEEEEECSSSSEEEEEEECTTGGGSTTEEEEECGGGCSSCSEESTTSCEESSCCSEECSTTCEEEEEEESSHHHHHH80 (732)
Q ss_pred81---------------CCHHHHHHCCCCCCCCCCEECCCHHHHHHHCCEEEEEEEEECCEEEEEECCCEEEEEEECCCCCE160 (732)
Q d20181004_281---------------VTIELAYANKSFEGSELKIEKGDPKKLFMEADNKDSGELWHGGQDKFYLETHCTIARDCGDEGDM160 (732)
T 1FO4_A81AAHVVKVTYEDLPAIITIEDAIKNNSFYGSELKIEKGDLKKGFSEADNVVSGELYIGGQDHFYLETHCTIAIPKGEEGEM160 (732)
T ss_pred81HHHCCCEEEECCCCCCCHHHHHCCCCCCCCCCCCCCCCHHHHHHHCCEEEEEEEEECCCCCCCCCCCEEEEEEECCCCEE160 (732)
T ss_dssp81HHHTCEEEEEECCCCCSHHHHHHHTCEEEEEEEEEESCHHHHHHHCSEEEEEEEEECCBCCCCSSCCEEEEEECSSTTCE160 (732)
Q ss_pred161EEEEECCCHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCC240 (732)
Q d20181004_2161ELFSRTQNAMKTDSFAAVMCGVPVNRILVRHARMGVKFKGKETRNGLVSVAEMLYAGKVKHDGYCALDRNEDMLIDGGRH240 (732)
T 1FO4_A161ELFVSTQNAMKTQSFVAKMLGVPVNRILVRVKRMGGGFGGKETRSTLVSVAVALAAYKTGHPVRCMLDRNEDMLITGGRH240 (732)
T ss_pred161EEEECCCCHHHHHHHHHHHHCCCHHHEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCCC240 (732)
T ss_dssp161EEEECCSCHHHHHHHHHHHHTSCGGGEEEEECCCSCCTTTTSSTTHHHHHHHHHHHHHHSSCEEEECCHHHHHHHSCCBC240 (732)
Q ss_pred241CEEEEEEEEECCCCCEEEEEEEEECCCCCCCCCCHHHHHHHHCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCCCHHHH320 (732)
Q d20181004_2241PFLARYKVYFMITWTIVILEVDSTINAAVSRDLSHSIMHRRLGDRDNCMKIKNIVETGRLCKIKLSSNMAFRGLGGPRAL320 (732)
T 1FO4_A241PFLARYKVGFMKTGTIVALEVDHYSNAGNSRDLSHSIMERALFHMDNCYKIPNIRGTGRLCKTNLSSNTAFRGFGGPQAL320 (732)
T ss_pred241CEEEEEEEEECCCCCEEEEEEEEEECCCCCCCCCHHHHHHHHHHCCCCCCCCEEEEEEEEEEECCCCCCCCCCCCCHHHH320 (732)
T ss_dssp241CEEEEEEEEECTTSCEEEEEEEEEEEEESSCTTHHHHHHHHHHTTTTTBCCSEEEEEEEEEECSSCCCCCCTTTTHHHHH320 (732)
Q ss_pred321HHHHHHHHHHHHHCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHCCCCCCCCCEEEE400 (732)
Q d20181004_2321FTAEAWISFVAVTCSLGDAEGRWWNMAFRGDLTHFNQRLISFSVPRCWDECLWSSQDYARKSMVNKFNLENCWAMRGLCL400 (732)
T 1FO4_A321FIAENWMSEVAVTCGLPAEEVRWKNMYKEGDLTHFNQRLEGFSVPRCWDECLKSSQYYARKSEVDKFNKENCWKKRGLCI400 (732)
T ss_pred321HHHHHHHHHHHHHHCCCHHHHHHHHCCCCCCCCCCCCEECCCCHHHHHHHHHHHCCHHHHHHHHHHHHCCCCEEEEEEEE400 (732)
T ss_dssp321HHHHHHHHHHHHHHTCCHHHHHHHHBCCTTCBCTTCCBCTTCCHHHHHHHHHHHHTHHHHHHHHHHHHHHCSSEEEEEEE400 (732)
Q ss_pred401EEECCCCCCCCCCCCCCCCEEEEECCCCEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCCCCCC480 (732)
Q d20181004_2401IDTKFGKSFTVPFGNQMGDLIHLYTTGSVSVSHWGTPMGNGPHTKMVQGASIALRTPIAKIYKLETSTGTGFNSDPTMNS480 (732)
T 1FO4_A401IPTKFGISFTVPFLNQAGALIHVYTDGSVLVSHGGTEMGQGLHTKMVQVASKALKIPISKIYISETSTNTVPNSSPTAAS480 (732)
T ss_pred401EEEEECCCCCCCCCCCEEEEEEECCCCEEEEEECCCCCCCCHHHHHHHHHHHHHCCCHHHEEEEECCCCCCCCCCCCCHH480 (732)
T ss_dssp401EEEEEEESCSSGGGCEEEEEEEECTTSCEEEEESCCCSSSCHHHHHHHHHHHHHTSCGGGEECCCEETTTSCSCCCSCTT480 (732)
Q ss_pred481HHHHHHHHHHHHHHHCCCCCCCHHHHHCCCCCHHHHHHHHHCCCEECCEEEEEECCCCCCCCCCCCCCCCCCCCCCEEEE560 (732)
Q d20181004_2481NNHDIYAQAVDEACQTPLMRVEPAKKKNKDGSKEMWEMAAYQDRVMLSTTGFYQFPPLSYMFETWSGAAFHYWTYGVEWS560 (732)
T 1FO4_A481VSTDIYGQAVYEACQTILKRLEPFKKKNPDGSWEDWVMAAYQDRVSLSTTGFYRTPNLGYSFETNSGNAFHYFTYGVACS560 (732)
T ss_pred481HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHEEEECCEEEEEHHHHHHHCCCCCCCCCCCCCCCCCCCCCCEEEEE560 (732)
T ss_dssp481CHHHHHHHHHHHHHHHHHHHHHHHHHHSTTSCHHHHHHHHHHTTCCCEEEEEEECSSCCCBTTTTBSCSCSEEEEEEEEE560 (732)
Q ss_pred561EEEEEECCCCEEEEEEEEEEECCCCCCHHHHHHHHCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCEEE640 (732)
Q d20181004_2561EAEIDCETDSHKNIPTDWIMDVGSSLNPAIKIDQVEGAFVQGFGHFTLAKLQYSPERSLHPPGPSAYWIPVFGSIPVEFR640 (732)
T 1FO4_A561EVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGSLHTRGPSTYKIPAFGSIPTEFR640 (732)
T ss_pred561EEEEECCCCCEEEEEEEEEEECCHHCCHHHHHHHHHHHHHHHHHHHHHHCEEECCCCCCCCCCHHHCCCCCCCCCCCCEE640 (732)
T ss_dssp561EEEEETTTCCEEEEEEEEEEECBSCSCTTHHHHHHHHHHHHHHHHHHTCCCCBCTTSCBCCCSTTTSCCCCGGGSCSEEE640 (732)
Q ss_pred641EECCCCCCCCCCEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC720 (732)
Q d20181004_2641YSLNKDCPKVIACYATIGVGTPPLFLGGSVFFAIKDAIIAFRAQHTNNNTKEHFELDSAATPEKINTAMVDKFETLVVTC720 (732)
T 1FO4_A641VSLLRDCPNKKAIYASKAVGEPPLFLGASVFFAIKDAIRAARAQHTNNNTKELFRLDSPATPEKIRNACVDKFTTLCVTG720 (732)
T ss_pred641EEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCC720 (732)
T ss_dssp641EEECSSCCCTTSGGGBCCCSSTTGGGGHHHHHHHHHHHHHHHHHHTCCCTTCCCCCCBSCCHHHHHHHSCCHHHHHTCSS720 (732)
Q ss_pred721CCCCCCCCCCCC732 (732)
Q d20181004_2721IPGNCKPWSLRV732 (732)
T 1FO4_A721APGNCKPWSLRV732 (732)
T ss_pred721CCCCCEEECCCC732 (732)
T ss_dssp721CCTTCCCSCCCC732 (732)


No 2
> 2E1Q_A        Alignment in PIR format
MAC score = 530.64	Identity = 0.63

Download partial structureDownload full-length structure
Q ss_pred1C-------------------------------------------------------------------------------80 (732)
Q d20181004_21I-------------------------------------------------------------------------------80 (732)
T 2E1Q_A1NELSLRLVTSTRAHAKIKSIDTSEAKKVPGFVCFISADDVPGSNITGICNDETVFAKDKVTCVGHIIGAVVADTPEHTQR80 (732)
T ss_pred1CCEEEEEEECCCCCEEEEEECHHHHHHCCCCEEEECHHHCCCCCCCCCCCCCCCCCCCEEEECCCEEEEEEECCHHHHHH80 (732)
T ss_dssp1TCEEEEEEECSSSSEEEEEEECTTGGGSTTEEEEEEGGGCSSCSEESTTSCEESSCCSEECSTTCEEEEEEESSHHHHHH80 (732)
Q ss_pred81---------------CCHHHHHHCCCCCCCCCCEECCCHHHHHHHCCEEEEEEEEECCEEEEEECCCEEEEEEECCCCCE160 (732)
Q d20181004_281---------------VTIELAYANKSFEGSELKIEKGDPKKLFMEADNKDSGELWHGGQDKFYLETHCTIARDCGDEGDM160 (732)
T 2E1Q_A81AAQGVKITYEELPAIITIEDAIKNNSFYGPELKIEKGDLKKGFSEADNVVSGEIYIGGQEHFYLETHCTIAVPKGEAGEM160 (732)
T ss_pred81HHHCCCEEEECCCCCCCHHHHHCCCCCCCCCCCCCCCCHHHHHHHCCEEEEEEEEECCCCCCCCCCCEEEEEEECCCCEE160 (732)
T ss_dssp81HHHTCEEEEEECCCCCSHHHHHHHTCEEEEEEEEEESCHHHHHHHCSEEEEEEEEECCBCCCCSSCCEEEEEECSSTTCE160 (732)
Q ss_pred161EEEEECCCHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCC240 (732)
Q d20181004_2161ELFSRTQNAMKTDSFAAVMCGVPVNRILVRHARMGVKFKGKETRNGLVSVAEMLYAGKVKHDGYCALDRNEDMLIDGGRH240 (732)
T 2E1Q_A161ELFVSTQNTMKTQSFVAKMLGVPANRIVVRVKRMGGGFGGKVTRSTVVSTAVALAAYKTGRPVRCMLDRDEDMLITGGRH240 (732)
T ss_pred161EEEECCCCHHHHHHHHHHHHCCCHHHEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCCC240 (732)
T ss_dssp161EEEECCSCHHHHHHHHHHHHTCCGGGEEEEESCCSCCTTTTSSTTHHHHHHHHHHHHHHSSCEEEECCHHHHHHHHCCBC240 (732)
Q ss_pred241CEEEEEEEEECCCCCEEEEEEEEECCCCCCCCCCHHHHHHHHCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCCCHHHH320 (732)
Q d20181004_2241PFLARYKVYFMITWTIVILEVDSTINAAVSRDLSHSIMHRRLGDRDNCMKIKNIVETGRLCKIKLSSNMAFRGLGGPRAL320 (732)
T 2E1Q_A241PFLARYKVGFMKTGTVVALEVDHFSNVGNTQDLSQSIMERALFHMDNCYKIPNIRGTGRLCKTNLPSNTAFRGFGGPQGM320 (732)
T ss_pred241CEEEEEEEEECCCCCEEEEEEEEEECCCCCCCCCHHHHHHHHHHCCCCCCCCEEEEEEEEEEECCCCCCCCCCCCCHHHH320 (732)
T ss_dssp241CEEEEEEEEECTTSCEEEEEEEEEEEEESSCTTHHHHHHHHHHTSSTTBCCSEEEEEEEEEECSSCCCCCCTTTTHHHHH320 (732)
Q ss_pred321HHHHHHHHHHHHHCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHCCCCCCCCCEEEE400 (732)
Q d20181004_2321FTAEAWISFVAVTCSLGDAEGRWWNMAFRGDLTHFNQRLISFSVPRCWDECLWSSQDYARKSMVNKFNLENCWAMRGLCL400 (732)
T 2E1Q_A321LIAECWMSEVAVTCGMPAEEVRRKNLYKEGDLTHFNQKLEGFTLPRCWEECLASSQYHARKSEVDKFNKENCWKKRGLCI400 (732)
T ss_pred321HHHHHHHHHHHHHHCCCHHHHHHHHCCCCCCCCCCCCEECCCCHHHHHHHHHHHCCHHHHHHHHHHHHHCCCEEEEEEEE400 (732)
T ss_dssp321HHHHHHHHHHHHHHTCCHHHHHHHTBCCTTCBCTTCCBCCSCCHHHHHHHHHHHHTHHHHHHHHHHHHHHCSSEEEEEEE400 (732)
Q ss_pred401EEECCCCCCCCCCCCCCCCEEEEECCCCEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCCCCCC480 (732)
Q d20181004_2401IDTKFGKSFTVPFGNQMGDLIHLYTTGSVSVSHWGTPMGNGPHTKMVQGASIALRTPIAKIYKLETSTGTGFNSDPTMNS480 (732)
T 2E1Q_A401IPTKFGISFTVPFLNQAGALLHVYTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIYISETSTNTVPNTSPTAAS480 (732)
T ss_pred401EEEEECCCCCCCCCCCEEEEEEECCCCEEEEEECCCCCCCCHHHHHHHHHHHHHCCCHHHEEEEECCCCCCCCCCCCCHH480 (732)
T ss_dssp401EEEEEEESCSSGGGCEEEEEEEECTTSCEEEEESCCCSSSCHHHHHHHHHHHHHTSCGGGEECCCEETTTSCSCCCSCTT480 (732)
Q ss_pred481HHHHHHHHHHHHHHHCCCCCCCHHHHHCCCCCHHHHHHHHHCCCEECCEEEEEECCCCCCCCCCCCCCCCCCCCCCEEEE560 (732)
Q d20181004_2481NNHDIYAQAVDEACQTPLMRVEPAKKKNKDGSKEMWEMAAYQDRVMLSTTGFYQFPPLSYMFETWSGAAFHYWTYGVEWS560 (732)
T 2E1Q_A481VSADLNGQAVYAACQTILKRLEPYKKKNPSGSWEDWVTAAYMDTVSLSATGFYRTPNLGYSFETNSGNPFHYFSYGVACS560 (732)
T ss_pred481HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHEEECCCCCEEEHHHEECCCCCCCCCCCCCCCCCCCCCCCCEEEEE560 (732)
T ss_dssp481CHHHHHHHHHHHHHHHHHHHHHHHHHHCTTCCHHHHHHHHHHTTCCCEEEEEEECSSCCCBTTTTBSCSCSEEEEEEEEE560 (732)
Q ss_pred561EEEEEECCCCEEEEEEEEEEECCCCCCHHHHHHHHCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCEEE640 (732)
Q d20181004_2561EAEIDCETDSHKNIPTDWIMDVGSSLNPAIKIDQVEGAFVQGFGHFTLAKLQYSPERSLHPPGPSAYWIPVFGSIPVEFR640 (732)
T 2E1Q_A561EVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGSLHTRGPSTYKIPAFGSIPIEFR640 (732)
T ss_pred561EEEEECCCCCEEEEEEEEEEECCHHCCHHHHHHHHHHHHHHHHHHHHCCCEEECCCCCCCCCCHHHCCCCCCCCCCCCEE640 (732)
T ss_dssp561EEEEETTTSCEEEEEEEEEEECBSCSCHHHHHHHHHHHHHHHHHHHHTCCCCBCTTSCBCCCSTTTSCCCCGGGSCSEEE640 (732)
Q ss_pred641EECCCCCCCCCCEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC720 (732)
Q d20181004_2641YSLNKDCPKVIACYATIGVGTPPLFLGGSVFFAIKDAIIAFRAQHTNNNTKEHFELDSAATPEKINTAMVDKFETLVVTC720 (732)
T 2E1Q_A641VSLLRDCPNKKAIYASKAVGEPPLFLAASIFFAIKDAIRAARAQHTGNNVKELFRLDSPATPEKIRNACVDKFTTLCVTG720 (732)
T ss_pred641EEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCC720 (732)
T ss_dssp641EEECSSCCCTTSGGGBCCCSSGGGGGGHHHHHHHHHHHHHHHHHHSSCCTTCCCCCCBSCCHHHHHHHSCCTTGGGCCCC720 (732)
Q ss_pred721CCCCCCCCCCCC732 (732)
Q d20181004_2721IPGNCKPWSLRV732 (732)
T 2E1Q_A721VPENCKPWSVRV732 (732)
T ss_pred721CCCCCCCCCCCC732 (732)
T ss_dssp721CCSSCCCSCBCC732 (732)


No 3
> 3AN1_A        Alignment in PIR format
MAC score = 527.5	Identity = 0.61

Download partial structureDownload full-length structure
Q ss_pred1C-------------------------------------------------------------------------------80 (732)
Q d20181004_21I-------------------------------------------------------------------------------80 (732)
T 3AN1_A1NELSLRLVTSTRAHAKITSIDTSEAKKVPGFVCFLTAEDVPNSNATGLFNDETVFAKDEVTCVGHIIGAVVADTPEHAQR80 (732)
T ss_pred1CCEEEEEEECCCCCEEEEEEEHHHHHCCCCCEEEEEHHHCCCCCCCCCCCCCCCCCCCEEEECCCEEEEEEECCHHHHHH80 (732)
T ss_dssp1TCEEEEEEECSSSSEEEEEEECTTGGGSTTEEEEECGGGCSSCCEESTTSCEESSCCSEECSTTCEEEEEEESSHHHHHH80 (732)
Q ss_pred81---------------CCHHHHHHCCCCCCCCCCEECCCHHHHHHHCCEEEEEEEEECCEEEEEECCCEEEEEEECCCCCE160 (732)
Q d20181004_281---------------VTIELAYANKSFEGSELKIEKGDPKKLFMEADNKDSGELWHGGQDKFYLETHCTIARDCGDEGDM160 (732)
T 3AN1_A81AARGVKITYEDLPAIITIQDAINNNSFYGSEIKIEKGDLKKGFSEADNVVSGELYIGGQEHFYLETNCTIAVPKGEAGEM160 (732)
T ss_pred81HHHCCCEEEECCCCCCCHHHHHCCCCCCCCCCCCCCCCHHHHHHHCCEEEEEEEEECCEEEECCCCEEEEEEEECCCCEE160 (732)
T ss_dssp81HHHTCEEEEEECCCCCSHHHHHHTTCBSSSCEEEEESCHHHHHHHCSEEEEEEEEECCBCCCCSSCCEEEEEECSSTTCE160 (732)
Q ss_pred161EEEEECCCHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCC240 (732)
Q d20181004_2161ELFSRTQNAMKTDSFAAVMCGVPVNRILVRHARMGVKFKGKETRNGLVSVAEMLYAGKVKHDGYCALDRNEDMLIDGGRH240 (732)
T 3AN1_A161ELFVSTQNTMKTQSFVAKMLGVPDNRIVVRVKRMGGGFGGKETRSTVVSTALALAAHKTGRPVRCMLDRDEDMLITGGRH240 (732)
T ss_pred161EEEECCCCHHHHHHHHHHHHCCCHHHEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCCC240 (732)
T ss_dssp161EEEECCSCHHHHHHHHHHHHTCCGGGEEEEESCCSCCTTTTSSTTHHHHHHHHHHHHHHSSCEEEECCHHHHHHHSCCBC240 (732)
Q ss_pred241CEEEEEEEEECCCCCEEEEEEEEECCCCCCCCCCHHHHHHHHCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCCCHHHH320 (732)
Q d20181004_2241PFLARYKVYFMITWTIVILEVDSTINAAVSRDLSHSIMHRRLGDRDNCMKIKNIVETGRLCKIKLSSNMAFRGLGGPRAL320 (732)
T 3AN1_A241PFLAKYKVGFMKTGTVVALEVAHFSNGGNTEDLSRSIMERALFHMDNAYKIPNIRGTGRICKTNLPSNTAFRGFGGPQGM320 (732)
T ss_pred241CEEEEEEEEECCCCEEEEEEEEEEECCCCCCCCCHHHHHHHHHHCCCCCCCCCEEEEEEEEECCCCCCCCCCCCCHHHHH320 (732)
T ss_dssp241CEEEEEEEEECTTSCEEEEEEEEEEECCSSCTTHHHHHHHHHHTTTTTBCCSSEEEEEEEECCSSCCCCCCTTTTHHHHH320 (732)
Q ss_pred321HHHHHHHHHHHHHCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHCCCCCCCCCEEEE400 (732)
Q d20181004_2321FTAEAWISFVAVTCSLGDAEGRWWNMAFRGDLTHFNQRLISFSVPRCWDECLWSSQDYARKSMVNKFNLENCWAMRGLCL400 (732)
T 3AN1_A321LIAEYWMSEVAITCGLPAEEVRRKNMYKEGDLTHFNQKLEGFTLPRCWDECIASSQYLARKREVEKFNRENCWKKRGLCI400 (732)
T ss_pred321HHHHHHHHHHHHHHCCCHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHCCCCCEEEEEEE400 (732)
T ss_dssp321HHHHHHHHHHHHHHTSCHHHHHHHHBCCTTCBCTTCCBCCSCCHHHHHHHHHHHTTHHHHHHHHHHHHHHCSSEEEEEEE400 (732)
Q ss_pred401EEECCCCCCCCCCCCCCCCEEEEECCCCEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCCCCCC480 (732)
Q d20181004_2401IDTKFGKSFTVPFGNQMGDLIHLYTTGSVSVSHWGTPMGNGPHTKMVQGASIALRTPIAKIYKLETSTGTGFNSDPTMNS480 (732)
T 3AN1_A401IPTKFGISFTLPFLNQGGALVHVYTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIHISETSTNTVPNTSPTAAS480 (732)
T ss_pred401EEEEEEECCCCCCCCCCCEEEEEECCCEEEEEECCCCCCCCHHHHHHHHHHHHHCCCHHHEEEEECCCCCCCCCCCCHHH480 (732)
T ss_dssp401EEEEEEESCSSGGGCEEEEEEEECTTSCEEEEESCCCSSSCHHHHHHHHHHHHHTSCGGGEECCCEETTTSCSCCCSCTT480 (732)
Q ss_pred481HHHHHHHHHHHHHHHCCCCCCCHHHHHCCCCCHHHHHHHHHCCCEECCEEEEEECCCCCCCCCCCCCCCCCCCCCCEEEE560 (732)
Q d20181004_2481NNHDIYAQAVDEACQTPLMRVEPAKKKNKDGSKEMWEMAAYQDRVMLSTTGFYQFPPLSYMFETWSGAAFHYWTYGVEWS560 (732)
T 3AN1_A481ASADLNGQGVYEACQTILKRLEPFKKKKPTGPWEAWVMDAYTSAVSLSATGFYKTPNLGYSFETNSGNPFHYFSYGVACS560 (732)
T ss_pred481HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCEEEEE560 (732)
T ss_dssp481CHHHHHHHHHHHHHHHHHHHHHHHHHHSSSSCHHHHHHHHHHTTCCCEEEEEEECCSCCCBTTTTBSCSCSEEEEEEEEE560 (732)
Q ss_pred561EEEEEECCCCEEEEEEEEEEECCCCCCHHHHHHHHCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCEEE640 (732)
Q d20181004_2561EAEIDCETDSHKNIPTDWIMDVGSSLNPAIKIDQVEGAFVQGFGHFTLAKLQYSPERSLHPPGPSAYWIPVFGSIPVEFR640 (732)
T 3AN1_A561EVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTMEELHYSPEGSLHTRGPSTYKIPAFGSIPIEFR640 (732)
T ss_pred561EEEEECCCCCEEEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCE640 (732)
T ss_dssp561EEEEETTTCCEEEEEEEEEEECBSCSCHHHHHHHHHHHHHHHHHHHHTCCCCBCTTSCBCCCSTTTSCCCCGGGSCSEEE640 (732)
Q ss_pred641EECCCCCCCCCCEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC720 (732)
Q d20181004_2641YSLNKDCPKVIACYATIGVGTPPLFLGGSVFFAIKDAIIAFRAQHTNNNTKEHFELDSAATPEKINTAMVDKFETLVVTC720 (732)
T 3AN1_A641VSLLRDCPNKRAIYASKAVGEPPLFLASSIFFAIKDAIRAARAQHG-DNAKQLFQLDSPATPEKIRNACVDQFTTLCVTG720 (732)
T ss_pred641EEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCC-CCCCCCEECCCCCCHHHHHHHHHHHHHHCCCCC720 (732)
T ss_dssp641EEECSSCCCTTSGGGBCCCSSTTGGGGHHHHHHHHHHHHHHHHHHC-SSCCSSCCCCBSCCHHHHHHHSCSHHHHHHCUU720 (732)
Q ss_pred721CCCCCCCCCCCC732 (732)
Q d20181004_2721IPGNCKPWSLRV732 (732)
T 3AN1_A721VPENCKSWSVRI732 (732)
T ss_pred721CCCCCCCCEECC732 (732)
T ss_dssp721UUUUCCCSCBCC732 (732)


No 4
> 1N5X_A        Alignment in PIR format
MAC score = 523.47	Identity = 0.71

Download partial structureDownload full-length structure
Q ss_pred1C-------------------------------------------------------------------------------80 (732)
Q d20181004_21I-------------------------------------------------------------------------------80 (732)
T 1N5X_A1NELFLRLVTSTRAHAKIKSIDVSEAQKVPGFVCFLSADDIPGSNETGLFNDETVFAKDTVTCVGHIIGAVVADTPEHAER80 (732)
T ss_pred1CCEEEEEEECCCCCEEEEEECHHHHHHCCCEEEEECHHHCCCCCCCCCCCCCCCCCCCEEEECCCEEEEEEECCHHHHHH80 (732)
T ss_dssp1TCEEEEEEECCSSSEEEEEEECTTGGGSTTEEEEEEGGGCSSCSEESTTSCEESSCCSEECSTTCEEEEEEESSHHHHHH80 (732)
Q ss_pred81---------------CCHHHHHHCCCCCCCCCCEECCCHHHHHHHCCEEEEEEEEECCEEEEEECCCEEEEEEECCCCCE160 (732)
Q d20181004_281---------------VTIELAYANKSFEGSELKIEKGDPKKLFMEADNKDSGELWHGGQDKFYLETHCTIARDCGDEGDM160 (732)
T 1N5X_A81AAHVVKVTYEDLPAIITIEDAIKNNSFYGSELKIEKGDLKKGFSEADNVVSGELYIGGQDHFYLETHCTIAIPKGEEGEM160 (732)
T ss_pred81HHHCCCEEEECCCCCCCHHHHHCCCCCCCCCCCCCCCCHHHHHHHCCEEEEEEEEECCCCCCCCCCCEEEEEEECCCCEE160 (732)
T ss_dssp81HHHTCEEEEEECCCCCSHHHHHHTTCBSSCCEEEEESCHHHHHHTCSEEEEEEEEECCBCCCCSSCCEEEEEECSSTTCE160 (732)
Q ss_pred161EEEEECCCHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCC240 (732)
Q d20181004_2161ELFSRTQNAMKTDSFAAVMCGVPVNRILVRHARMGVKFKGKETRNGLVSVAEMLYAGKVKHDGYCALDRNEDMLIDGGRH240 (732)
T 1N5X_A161ELFVSTQNAMKTQSFVAKMLGVPVNRILVRVKRMGGGFGGKETRSTLVSVAVALAAYKTGHPVRCMLDRNEDMLITGGRH240 (732)
T ss_pred161EEEECCCCHHHHHHHHHHHHCCCHHHEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCCC240 (732)
T ss_dssp161EEEECCSCHHHHHHHHHHHHTSCGGGEEEEECCCSCCTTTTSSTTHHHHHHHHHHHHHHSSCEEEECCHHHHHHHSCCBC240 (732)
Q ss_pred241CEEEEEEEEECCCCCEEEEEEEEECCCCCCCCCCHHHHHHHHCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCCCHHHH320 (732)
Q d20181004_2241PFLARYKVYFMITWTIVILEVDSTINAAVSRDLSHSIMHRRLGDRDNCMKIKNIVETGRLCKIKLSSNMAFRGLGGPRAL320 (732)
T 1N5X_A241PFLARYKVGFMKTGTIVALEVDHYSNAGNSRDLSHSIMERALFHMDNCYKIPNIRGTGRLCKTNLSSNTAFRGFGGPQAL320 (732)
T ss_pred241CEEEEEEEEECCCCCEEEEEEEEEECCCCCCCCCHHHHHHHHHHCCCCCCCCEEEEEEEEEEECCCCCCCCCCCCCHHHH320 (732)
T ss_dssp241CEEEEEEEEECTTCCEEEEEEEEEEEEESSCTTHHHHHHHHHTTTTTTBCCSEEEEEEEEEECSSCCCCCCTTTTHHHHH320 (732)
Q ss_pred321HHHHHHHHHHHHHCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHCCCCCCCCCEEEE400 (732)
Q d20181004_2321FTAEAWISFVAVTCSLGDAEGRWWNMAFRGDLTHFNQRLISFSVPRCWDECLWSSQDYARKSMVNKFNLENCWAMRGLCL400 (732)
T 1N5X_A321FIAENWMSEVAVTCGLPAEEVRWKNMYKEGDLTHFNQRLEGFSVPRCWDECLKSSQYYARKSEVDKFNKENCWKKRGLCI400 (732)
T ss_pred321HHHHHHHHHHHHHHCCCHHHHHHHHCCCCCCCCCCCCEECCCCHHHHHHHHHHHCCHHHHHHHHHHHHCCCCEEEEEEEE400 (732)
T ss_dssp321HHHHHHHHHHHHHHTCCHHHHHHHHBCCTTCBCTTCCBCTTCCHHHHHHHHHHHHTHHHHHHHHHHHHHHCSSEEEEEEE400 (732)
Q ss_pred401EEECCCCCCCCCCCCCCCCEEEEECCCCEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCCCCCC480 (732)
Q d20181004_2401IDTKFGKSFTVPFGNQMGDLIHLYTTGSVSVSHWGTPMGNGPHTKMVQGASIALRTPIAKIYKLETSTGTGFNSDPTMNS480 (732)
T 1N5X_A401IPTKFGISFTVPFLNQAGALIHVYTDGSVLVSHGGTEMGQGLHTKMVQVASKALKIPISKIYISETSTNTVPNSSPTAAS480 (732)
T ss_pred401EEEEECCCCCCCCCCCEEEEEEECCCCEEEEEECCCCCCCCHHHHHHHHHHHHHCCCHHHEEEEECCCCCCCCCCCCCHH480 (732)
T ss_dssp401EEEEEEESCSSGGGCEEEEEEEECTTSCEEEEESCCCSSSCHHHHHHHHHHHHHTSCGGGEEECCEETTTSCSCCCSCTT480 (732)
Q ss_pred481HHHHHHHHHHHHHHHCCCCCCCHHHHHCCCCCHHHHHHHHHCCCEECCEEEEEECCCCCCCCCCCCCCCCCCCCCCEEEE560 (732)
Q d20181004_2481NNHDIYAQAVDEACQTPLMRVEPAKKKNKDGSKEMWEMAAYQDRVMLSTTGFYQFPPLSYMFETWSGAAFHYWTYGVEWS560 (732)
T 1N5X_A481VSTDIYGQAVYEACQTILKRLEPFKKKNPDGSWEDWVMAAYQDRVSLSTTGFYRTPNLGYSFETNSGNAFHYFTYGVACS560 (732)
T ss_pred481HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHEEEECCEEEEEHHHHHHHCCCCCCCCCCCCCCCCCCCCCCEEEEE560 (732)
T ss_dssp481THHHHHHHHHHHHHHHHHHHHHHHHHHCTTCCHHHHHHHHHHTTCCCEEEEEEECSSCCCBTTTTBSCSCSEEEEEEEEE560 (732)
Q ss_pred561EEEEEECCCCEEEEEEEEEEECCCCCCHHHHHHHHCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCEEE640 (732)
Q d20181004_2561EAEIDCETDSHKNIPTDWIMDVGSSLNPAIKIDQVEGAFVQGFGHFTLAKLQYSPERSLHPPGPSAYWIPVFGSIPVEFR640 (732)
T 1N5X_A561EVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGSLHTRGPSTYKIPAFGSIPTEFR640 (732)
T ss_pred561EEEEECCCCCEEEEEEEEEEECCHHCCHHHHHHHHHHHHHHHHHHHHHHCEEECCCCCCCCCCHHHCCCCCCCCCCCCEE640 (732)
T ss_dssp561EEEEETTTSCEEEEEEEEEEECBSCSCTTHHHHHHHHHHHHHHHHHHTCCCCBCTTSCBCCCSTTTSCCCCGGGSCSEEE640 (732)
Q ss_pred641EECCCCCCCCCCEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC720 (732)
Q d20181004_2641YSLNKDCPKVIACYATIGVGTPPLFLGGSVFFAIKDAIIAFRAQHTNNNTKEHFELDSAATPEKINTAMVDKFETLVVTC720 (732)
T 1N5X_A641VSLLRDCPNKKAIYASKAVGEPPLFLGASVFFAIKDAIRAARAQHTNNNTKELFRLDSPATPEKIRNACVDKFTTLCVTG720 (732)
T ss_pred641EEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCC720 (732)
T ss_dssp641EEECSSCCCTTSGGGBCCCSSGGGGGGHHHHHHHHHHHHHHHHHHSCCCTTCCCCCCBSCCHHHHHHTSCSHHHHCUUUU720 (732)
Q ss_pred721CCCCCCCCCCCC732 (732)
Q d20181004_2721IPGNCKPWSLRV732 (732)
T 1N5X_A721APGNCKPWSLRV732 (732)
T ss_pred721CCCCCEECCCCC732 (732)
T ss_dssp721UUUUUCCSSCCC732 (732)


No 5
> 3NRZ_C        Alignment in PIR format
MAC score = 521.13	Identity = 0.71

Download partial structureDownload full-length structure
Q ss_pred1C-------------------------------------------------------------------------------80 (726)
Q d20181004_21I-------------------------------------------------------------------------------80 (726)
T 3NRZ_C1NELFLRLVTSTRAHAKIKSIDVSEAQKVPGFVCFLSADDIPGSNETGLFNDETVFAKDTVTCVGHIIGAVVADTPEHAER80 (726)
T ss_pred1CCEEEEEEECCCCCEEEEECCHHHHHHCCCCEEEEEHHHCCCCCCCCCCCCCCCCCCCEEEECCCEEEEEEECCHHHHHH80 (726)
T ss_dssp1TCEEEEEEECSSSSEEEEEEECTTGGGSTTEEEEECGGGCSSCSEESTTSCEESSCCSEECSTTCEEEEEEESSHHHHHH80 (726)
Q ss_pred81---------------CCHHHHHHCCCCCCCCCCEECCCHHHHHHHCCEEEEEEEEECCEEEEEECCCEEEEEEECCCCCE160 (726)
Q d20181004_281---------------VTIELAYANKSFEGSELKIEKGDPKKLFMEADNKDSGELWHGGQDKFYLETHCTIARDCGDEGDM160 (726)
T 3NRZ_C81AAHVVKVTYEDLPAIITIEDAIKNNSFYGSELKIEKGDLKKGFSEADNVVSGELYIGGQDHFYLETHCTIAIPKGEEGEM160 (726)
T ss_pred81HHHHCCEEEEECCCCCCHHHHHCCCCCCCCCCCCCCCCHHHHHHHCCEEEEEEEEECCEECCCCCCCEEEEEEECCCCEE160 (726)
T ss_dssp81HHHTCEEEEEECCCCCSHHHHHHHTCEEEEEEEEEESCHHHHHHHCSEEEEEEEEECCBCCCCSSCCEEEEEECSSTTCE160 (726)
Q ss_pred161EEEEECCCHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCC240 (726)
Q d20181004_2161ELFSRTQNAMKTDSFAAVMCGVPVNRILVRHARMGVKFKGKETRNGLVSVAEMLYAGKVKHDGYCALDRNEDMLIDGGRH240 (726)
T 3NRZ_C161ELFVSTQNAMKTQSFVAKMLGVPVNRILVRVKRMGGGFGGKETRSTLVSVAVALAAYKTGHPVRCMLDRNEDMLITGGRH240 (726)
T ss_pred161EEEECCCCHHHHHHHHHHHHCCCHHHEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCCC240 (726)
T ss_dssp161EEEECCSCHHHHHHHHHHHHTCCGGGEEEEECCCSCCTTTTSSTTHHHHHHHHHHHHHHSSCEEEECCHHHHHHHSCCBC240 (726)
Q ss_pred241CEEEEEEEEECCCCCEEEEEEEEECCCCCCCCCCHHHHHHHHCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCCCHHHH320 (726)
Q d20181004_2241PFLARYKVYFMITWTIVILEVDSTINAAVSRDLSHSIMHRRLGDRDNCMKIKNIVETGRLCKIKLSSNMAFRGLGGPRAL320 (726)
T 3NRZ_C241PFLARYKVGFMKTGTIVALEVDHYSNAGNSRDLSHSIMERALFHMDNCYKIPNIRGTGRLCKTNLSSNTAFRGFGGPQAL320 (726)
T ss_pred241CEEEEEEEEECCCCCEEEEEEEEEEECCCCCCCCCCHHHHHHHHCCCCCCCCEEEEEEEEEEECCCCCCCCCCCCCHHHH320 (726)
T ss_dssp241CEEEEEEEEECTTSCEEEEEEEEEEEEESSCTTHHHHHHHHHHTTTTTBCCSSEEEEEEEEECSSCCCCCCTTTTHHHHH320 (726)
Q ss_pred321HHHHHHHHHHHHHCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHCCCCCCCCCEEEE400 (726)
Q d20181004_2321FTAEAWISFVAVTCSLGDAEGRWWNMAFRGDLTHFNQRLISFSVPRCWDECLWSSQDYARKSMVNKFNLENCWAMRGLCL400 (726)
T 3NRZ_C321FIAENWMSEVAVTCGLPAEEVRWKNMYKEGDLTHFNQRLEGFSVPRCWDECLKSSQYYARKSEVDKFNKENCWKKRGLCI400 (726)
T ss_pred321HHHHHHHHHHHHHHCCCHHHHHHHHCCCCCCCCCCCCEECCCCHHHHHHHHHHHCCHHHHHHHHHHHHCCCCCEEEEEEE400 (726)
T ss_dssp321HHHHHHHHHHHHHHTCCHHHHHHHHBCCTTCBCTTCCBCTTCCHHHHHHHHHHHTTHHHHHHHHHHHHHHCSSEEEEEEE400 (726)
Q ss_pred401EEECCCCCCCCCCCCCCCCEEEEECCCCEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCCCCCC480 (726)
Q d20181004_2401IDTKFGKSFTVPFGNQMGDLIHLYTTGSVSVSHWGTPMGNGPHTKMVQGASIALRTPIAKIYKLETSTGTGFNSDPTMNS480 (726)
T 3NRZ_C401IPTKFGISFTVPFLNQAGALIHVYTDGSVLVSHGGTEMGQGLHTKMVQVASKALKIPISKIYISETSTNTVPNSSPTAAS480 (726)
T ss_pred401EEEEEEECCCCCCCCCCEEEEEEECCCEEEEEECCCCCCCHHHHHHHHHHHHHHCCCHHHEEEEECCCCCCCCCCCCHHH480 (726)
T ss_dssp401EEEEEEESCSSGGGCEEEEEEEECTTSCEEEEESCCCSSSCHHHHHHHHHHHHHTSCGGGEECCCEETTTSCSCCCSCTT480 (726)
Q ss_pred481HHHHHHHHHHHHHHHCCCCCCCHHHHHCCCCCHHHHHHHHHCCCEECCEEEEEECCCCCCCCCCCCCCCCCCCCCCEEEE560 (726)
Q d20181004_2481NNHDIYAQAVDEACQTPLMRVEPAKKKNKDGSKEMWEMAAYQDRVMLSTTGFYQFPPLSYMFETWSGAAFHYWTYGVEWS560 (726)
T 3NRZ_C481VSTDIYGQAVYEACQTILKRLEPFKKKNPDGSWEDWVMAAYQDRVSLSTTGFYRTPNLGYSFETNSGNAFHYFTYGVACS560 (726)
T ss_pred481HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHEEEECCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCEEEEEE560 (726)
T ss_dssp481CHHHHHHHHHHHHHHHHHHHHHHHHHHCTTSCHHHHHHHHHHTTCCCEEEEEEECSSCCCBTTTTBSCSCSEEEEEEEEE560 (726)
Q ss_pred561EEEEEECCCCEEEEEEEEEEECCCCCCHHHHHHHHCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCEEE640 (726)
Q d20181004_2561EAEIDCETDSHKNIPTDWIMDVGSSLNPAIKIDQVEGAFVQGFGHFTLAKLQYSPERSLHPPGPSAYWIPVFGSIPVEFR640 (726)
T 3NRZ_C561EVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGSLHTRGPSTYKIPAFGSIPTEFR640 (726)
T ss_pred561EEEEECCCCCEEEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHCCCEEECCCCCCCCCCHHHCCCCCCCCCCCEEE640 (726)
T ss_dssp561EEEEETTTCCEEEEEEEEEEECBSCSCHHHHHHHHHHHHHHHHHHHHTCCCCBCTTSCBCCCSTTTSCCCCGGGSCSEEE640 (726)
Q ss_pred641EECCCCCCCCCCEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC720 (726)
Q d20181004_2641YSLNKDCPKVIACYATIGVGTPPLFLGGSVFFAIKDAIIAFRAQHTNNNTKEHFELDSAATPEKINTAMVDKFETLVVTC720 (726)
T 3NRZ_C641VSLLRDCPNKKAIYASKAVGEPPLFLGASVFFAIKDAIRAARAQHTNNNTKELFRLDSPATPEKIRNACVDKFTTLCVTG720 (726)
T ss_pred641EEEECCCCCCCCCCEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCC720 (726)
T ss_dssp641EEECSSCCCTTSGGGBCCCSSGGGGGGHHHHHHHHHHHHHHHHHHSCSCTTCCCCCCBSCCHHHHHHHSCSTTTSCGGGT720 (726)
Q ss_pred721CCCCCC726 (726)
Q d20181004_2721IPGNCK726 (726)
T 3NRZ_C721APGNCK726 (726)
T ss_pred721CCCCCC726 (726)
T ss_dssp721CCCSCC726 (726)


No 6
> 3SR6_C        Alignment in PIR format
MAC score = 520.27	Identity = 0.71

Download partial structureDownload full-length structure
Q ss_pred1C-------------------------------------------------------------------------------80 (715)
Q d20181004_21I-------------------------------------------------------------------------------80 (715)
T 3SR6_C1NELFLRLVTSTRAHAKIKSIDVSEAQKVPGFVCFLSADDIPGSNETGLFNDETVFAKDTVTCVGHIIGAVVADTPEHAER80 (715)
T ss_pred1CCEEEEEEECCCCCEEEEEEEHHHHHHCCCCEEEEEHHHCCCCCCCCCCCCCCCCCCCEEEECCCEEEEEEECCHHHHHH80 (715)
T ss_dssp1TCEEEEEEECSSSSEEEEEEECTTTTTSTTEEEEECGGGCSSCSEESTTSCEESSCCSEECSTTCEEEEEEESSHHHHHH80 (715)
Q ss_pred81---------------CCHHHHHHCCCCCCCCCCEECCCHHHHHHHCCEEEEEEEEECCEEEEEECCCEEEEEEECCCCCE160 (715)
Q d20181004_281---------------VTIELAYANKSFEGSELKIEKGDPKKLFMEADNKDSGELWHGGQDKFYLETHCTIARDCGDEGDM160 (715)
T 3SR6_C81AAHVVKVTYEDLPAIITIEDAIKNNSFYGSELKIEKGDLKKGFSEADNVVSGELYIGGQDHFYLETHCTIAIPKGEEGEM160 (715)
T ss_pred81HHCCCCEEEEECCCCCCHHHHHCCCCCCCCCCCCCCCCHHHHHHHCCEEEEEEEEECCEEEECCCCEEEEEEEECCCCEE160 (715)
T ss_dssp81HHHTCEEEEEECCCCCSHHHHHHTTCEEEEEEEEEESCHHHHHHHCSEEEEEEEEECCBCCCCSSCCEEEEEECSSTTCE160 (715)
Q ss_pred161EEEEECCCHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCC240 (715)
Q d20181004_2161ELFSRTQNAMKTDSFAAVMCGVPVNRILVRHARMGVKFKGKETRNGLVSVAEMLYAGKVKHDGYCALDRNEDMLIDGGRH240 (715)
T 3SR6_C161ELFVSTQNAMKTQSFVAKMLGVPVNRILVRVKRMGGGFGGKETRSTLVSVAVALAAYKTGHPVRCMLDRNEDMLITGGRH240 (715)
T ss_pred161EEEECCCCHHHHHHHHHHHHCCCHHHEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECHHHHHHCCCCCC240 (715)
T ss_dssp161EEEECCSCHHHHHHHHHHHHTCCGGGEEEEESCCSCCTTTTSSTTHHHHHHHHHHHHHHSSCEEEECCHHHHHHHSCCBC240 (715)
Q ss_pred241CEEEEEEEEECCCCCEEEEEEEEECCCCCCCCCCHHHHHHHHCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCCCHHHH320 (715)
Q d20181004_2241PFLARYKVYFMITWTIVILEVDSTINAAVSRDLSHSIMHRRLGDRDNCMKIKNIVETGRLCKIKLSSNMAFRGLGGPRAL320 (715)
T 3SR6_C241PFLARYKVGFMKTGTIVALEVDHYSNAGNSRDLSHSIMERALFHMDNCYKIPNIRGTGRLCKTNLSSNTAFRGFGGPQAL320 (715)
T ss_pred241CEEEEEEEEECCCCCEEEEEEEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCEEEEEEEEECCCCCCCCCCCCCHHHHH320 (715)
T ss_dssp241CEEEEEEEEECTTSCEEEEEEEEEEEEESSCTTHHHHHHHHHHHTTTTBCCSSEEEEEEEEECSSCCCCCCTTTTHHHHH320 (715)
Q ss_pred321HHHHHHHHHHHHHCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHCCCCCCCCCEEEE400 (715)
Q d20181004_2321FTAEAWISFVAVTCSLGDAEGRWWNMAFRGDLTHFNQRLISFSVPRCWDECLWSSQDYARKSMVNKFNLENCWAMRGLCL400 (715)
T 3SR6_C321FIAENWMSEVAVTCGLPAEEVRWKNMYKEGDLTHFNQRLEGFSVPRCWDECLKSSQYYARKSEVDKFNKENCWKKRGLCI400 (715)
T ss_pred321HHHHHHHHHHHHHHCCCHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHCCCCCCCCCEEE400 (715)
T ss_dssp321HHHHHHHHHHHHHHTCCHHHHHHHHBCCTTCBCTTCCBCTTCCHHHHHHHHHHHHTHHHHHHHHHHHHHHCSSEEEEEEE400 (715)
Q ss_pred401EEECCCCCCCCCCCCCCCCEEEEECCCCEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCCCCCC480 (715)
Q d20181004_2401IDTKFGKSFTVPFGNQMGDLIHLYTTGSVSVSHWGTPMGNGPHTKMVQGASIALRTPIAKIYKLETSTGTGFNSDPTMNS480 (715)
T 3SR6_C401IPTKFGISFTVPFLNQAGALIHVYTDGSVLVSHGGTEMGQGLHTKMVQVASKALKIPISKIYISETSTNTVPNSSPTAAS480 (715)
T ss_pred401EEEEEEECCCCCCCCCCCEEEEECCCCEEEEEECCCCCCCCHHHHHHHHHHHHHCCCHHHEEEEECCCCCCCCCCCCHHH480 (715)
T ss_dssp401EEEEEEESCSSGGGCEEEEEEEECTTSCEEEEESCCCSSSCHHHHHHHHHHHHHTSCGGGEEECCEETTTSCSCCCSCTT480 (715)
Q ss_pred481HHHHHHHHHHHHHHHCCCCCCCHHHHHCCCCCHHHHHHHHHCCCEECCEEEEEECCCCCCCCCCCCCCCCCCCCCCEEEE560 (715)
Q d20181004_2481NNHDIYAQAVDEACQTPLMRVEPAKKKNKDGSKEMWEMAAYQDRVMLSTTGFYQFPPLSYMFETWSGAAFHYWTYGVEWS560 (715)
T 3SR6_C481VSTDIYGQAVYEACQTILKRLEPFKKKNPDGSWEDWVMAAYQDRVSLSTTGFYRTPNLGYSFETNSGNAFHYFTYGVACS560 (715)
T ss_pred481HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCEEEEE560 (715)
T ss_dssp481CHHHHHHHHHHHHHHHHHHHTHHHHHHSTTSCHHHHHHHHHHTTCCCEEEEEEECCSCCCBTTTTBSCSCSEEEEEEEEE560 (715)
Q ss_pred561EEEEEECCCCEEEEEEEEEEECCCCCCHHHHHHHHCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCEEE640 (715)
Q d20181004_2561EAEIDCETDSHKNIPTDWIMDVGSSLNPAIKIDQVEGAFVQGFGHFTLAKLQYSPERSLHPPGPSAYWIPVFGSIPVEFR640 (715)
T 3SR6_C561EVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGSLHTRGPSTYKIPAFGSIPTEFR640 (715)
T ss_pred561EEEEECCCCCEEEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHCCCEEECCCCCCCCCCHHHCCCCCHHHCCCCEE640 (715)
T ss_dssp561EEEEETTTCCEEEEEEEEEEECBSCSCHHHHHHHHHHHHHHHHHHHHTCCCCBCTTSCBCCCSTTTSCCCCGGGSCSEEE640 (715)
Q ss_pred641EECCCCCCCCCCEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH715 (715)
Q d20181004_2641YSLNKDCPKVIACYATIGVGTPPLFLGGSVFFAIKDAIIAFRAQHTNNNTKEHFELDSAATPEKINTAMVDKFET715 (715)
T 3SR6_C641VSLLRDCPNKKAIYASKAVGEPPLFLGASVFFAIKDAIRAARAQHTNNNTKELFRLDSPATPEKIRNACVDKFTT715 (715)
T ss_pred641EEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHCC715 (715)
T ss_dssp641EEECSSCCCTTSGGGBCCCSSGGGGGGHHHHHHHHHHHHHHHHHHTCSCTTCCCCCCBSCCHHHHHHHSCCTTTC715 (715)


No 7
> 2E3T_A        Alignment in PIR format
MAC score = 517.14	Identity = 0.61

Download partial structureDownload full-length structure
Q ss_pred1C-------------------------------------------------------------------------------80 (732)
Q d20181004_21I-------------------------------------------------------------------------------80 (732)
T 2E3T_A1NELSLRLVTSTRAHAKITSIDTSEAKKVPGFVCFLTAEDVPNSNATGLFNDETVFAKDEVTCVGHIIGAVVADTPEHAQR80 (732)
T ss_pred1CCEEEEEEECCCCCEEEEEECHHHHHHCCCCEEEECHHHCCCCCCCCCCCCCCCCCCCEEEECCCEEEEEEECCHHHHHH80 (732)
T ss_dssp1TCEEEEEEECSSSSEEEEEEECHHHHHSTTEEEEECGGGCSSCCEESTTSCEESSCCSEECSTTCEEEEEEESSHHHHHH80 (732)
Q ss_pred81---------------CCHHHHHHCCCCCCCCCCEECCCHHHHHHHCCEEEEEEEEECCEEEEEECCCEEEEEEECCCCCE160 (732)
Q d20181004_281---------------VTIELAYANKSFEGSELKIEKGDPKKLFMEADNKDSGELWHGGQDKFYLETHCTIARDCGDEGDM160 (732)
T 2E3T_A81AARGVKITYEDLPAIITIQDAINNNSFYGSEIKIEKGDLKKGFSEADNVVSGELYIGGQEHFYLETNCTIAVPKGEAGEM160 (732)
T ss_pred81HHHHCCEEEECCCCCCCHHHHHCCCCCCCCCHHCCCCCHHHHHHHCCEEEEEEEEECCCCCCCCCCCEEEEEEECCCCEE160 (732)
T ss_dssp81HHHTCEEEEEECCCCCSHHHHHHTTCBSSSCEEEEESCHHHHHHHCSEEEEEEEEECCBCCCCSSCCEEEEEECSSTTCE160 (732)
Q ss_pred161EEEEECCCHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCC240 (732)
Q d20181004_2161ELFSRTQNAMKTDSFAAVMCGVPVNRILVRHARMGVKFKGKETRNGLVSVAEMLYAGKVKHDGYCALDRNEDMLIDGGRH240 (732)
T 2E3T_A161ELFVSTQNTMKTQSFVAKMLGVPDNRIVVRVKRMGGGFGGKETRSTVVSTALALAAHKTGRPVRCMLDRDEDMLITGGRH240 (732)
T ss_pred161EEEECCCCHHHHHHHHHHHHCCCHHHEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCCC240 (732)
T ss_dssp161EEEECCSCHHHHHHHHHHHHTCCGGGEEEEESCCSCCTTTTSSTTHHHHHHHHHHHHHHSSCEEEECCHHHHHHHSCCBC240 (732)
Q ss_pred241CEEEEEEEEECCCCCEEEEEEEEECCCCCCCCCCHHHHHHHHCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCCCHHHH320 (732)
Q d20181004_2241PFLARYKVYFMITWTIVILEVDSTINAAVSRDLSHSIMHRRLGDRDNCMKIKNIVETGRLCKIKLSSNMAFRGLGGPRAL320 (732)
T 2E3T_A241PFLAKYKVGFMKTGTVVALEVAHFSNGGNTEDLSRSIMERALFHMDNAYKIPNIRGTGRICKTNLPSNTAFRGFGGPQGM320 (732)
T ss_pred241CEEEEEEEEECCCCCEEEEEEEEEEECCCCCCCCHHHHHHHHHHCCCCCCCCEEEEEEEEEEECCCCCCCCCCCCCHHHH320 (732)
T ss_dssp241CEEEEEEEEECTTSCEEEEEEEEEEECCSSCTTHHHHHHHHHHTTTTTBCCSEEEEEEEEECCSSCCCCCCTTTTHHHHH320 (732)
Q ss_pred321HHHHHHHHHHHHHCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHCCCCCCCCCEEEE400 (732)
Q d20181004_2321FTAEAWISFVAVTCSLGDAEGRWWNMAFRGDLTHFNQRLISFSVPRCWDECLWSSQDYARKSMVNKFNLENCWAMRGLCL400 (732)
T 2E3T_A321LIAEYWMSEVAITCGLPAEEVRRKNMYKEGDLTHFNQKLEGFTLPRCWDECIASSQYLARKREVEKFNRENCWKKRGLCI400 (732)
T ss_pred321HHHHHHHHHHHHHHCCCHHHHHHHHCCCCCCCCCCCCEECCCCHHHHHHHHHHHCCHHHHHHHHHHHHCCCCEEEEEEEE400 (732)
T ss_dssp321HHHHHHHHHHHHHHTSCHHHHHHHHBCCTTCBCTTCCBCCSCCHHHHHHHHHHHTTHHHHHHHHHHHHHHCSSEEEEEEE400 (732)
Q ss_pred401EEECCCCCCCCCCCCCCCCEEEEECCCCEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCCCCCC480 (732)
Q d20181004_2401IDTKFGKSFTVPFGNQMGDLIHLYTTGSVSVSHWGTPMGNGPHTKMVQGASIALRTPIAKIYKLETSTGTGFNSDPTMNS480 (732)
T 2E3T_A401IPTKFGISFTLPFLNQGGALVHVYTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIHISETSTNTVPNTSPTAAS480 (732)
T ss_pred401EEEECCCCCCCCCCCCCEEEEEECCCCEEEEEECCCCCCCCHHHHHHHHHHHHHCCCHHHEEEEECCCCCCCCCCCCCHH480 (732)
T ss_dssp401EEEEEEESCSSGGGCEEEEEEEECTTSCEEEEESCCCSSSCHHHHHHHHHHHHHTSCGGGEEECCEETTTSCSCCCSCTT480 (732)
Q ss_pred481HHHHHHHHHHHHHHHCCCCCCCHHHHHCCCCCHHHHHHHHHCCCEECCEEEEEECCCCCCCCCCCCCCCCCCCCCCEEEE560 (732)
Q d20181004_2481NNHDIYAQAVDEACQTPLMRVEPAKKKNKDGSKEMWEMAAYQDRVMLSTTGFYQFPPLSYMFETWSGAAFHYWTYGVEWS560 (732)
T 2E3T_A481ASADLNGQGVYEACQTILKRLEPFKKKKPTGPWEAWVMDAYTSAVSLSATGFYKTPNLGYSFETNSGNPFHYFSYGVACS560 (732)
T ss_pred481HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHEEECCCCCEEEHHHEECCCCCCCCCCCCCCCCCCCCCCCCEEEEE560 (732)
T ss_dssp481CHHHHHHHHHHHHHHHHHHHHHHHHHHSSSSCHHHHHHHHHHTTCCCEEEEEEECCSCCCBTTTTBSCSCSEEEEEEEEE560 (732)
Q ss_pred561EEEEEECCCCEEEEEEEEEEECCCCCCHHHHHHHHCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCEEE640 (732)
Q d20181004_2561EAEIDCETDSHKNIPTDWIMDVGSSLNPAIKIDQVEGAFVQGFGHFTLAKLQYSPERSLHPPGPSAYWIPVFGSIPVEFR640 (732)
T 2E3T_A561EVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTMEELHYSPEGSLHTRGPSTYKIPAFGSIPIEFR640 (732)
T ss_pred561EEEEECCCCCEEEEEEEEEEECCHHCCHHHHHHHHHHHHHHHHHHHHHHCEEECCCCCCCCCCHHHCCCCCCCCCCCCEE640 (732)
T ss_dssp561EEEEETTTCCEEEEEEEEEEECBSCSCHHHHHHHHHHHHHHHHHHHHTCCCCBCTTSCBCCCSTTTSCCCCGGGSCSEEE640 (732)
Q ss_pred641EECCCCCCCCCCEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC720 (732)
Q d20181004_2641YSLNKDCPKVIACYATIGVGTPPLFLGGSVFFAIKDAIIAFRAQHTNNNTKEHFELDSAATPEKINTAMVDKFETLVVTC720 (732)
T 2E3T_A641VSLLRDCPNKRAIYASKAVGEPPLFLASSIFFAIKDAIRAARAQHGDNA-KQLFQLDSPATPEKIRNACVDQFTTLCVTG720 (732)
T ss_pred641EEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCC-CCCEEECCCCCHHHHHHHHHHHHHHCCCCC720 (732)
T ss_dssp641EEECSSCCCTTSGGGBCCCSSTTGGGGHHHHHHHHHHHHHHHHHHSSSS-CCCCCCCBSCCHHHHHHHSCCTTTTTTTCU720 (732)
Q ss_pred721CCCCCCCCCCCC732 (732)
Q d20181004_2721IPGNCKPWSLRV732 (732)
T 2E3T_A721VPENCKSWSVRI732 (732)
T ss_pred721CCCCCEECCCCC732 (732)
T ss_dssp721UUUUUUUUUUUU732 (732)


No 8
> 2CKJ_A        Alignment in PIR format
MAC score = 512.98	Identity = 0.62

Download partial structureDownload full-length structure
Q ss_pred1C------------------------------CCHHHHHH-CCCC------------------------------------80 (729)
Q d20181004_21I------------------------------VTIELAYA-NKSF------------------------------------80 (729)
T 2CKJ_A1SLRLVTSTRAHAKIKSIDTSEAKKVPGFVCFISADDVPGSNITGICNDETVFAKDKVTCVGHIIGAVVADTPEHTQRAAQ80 (729)
T ss_pred1EEEEEECCCCCEEEEEECHHHHHHCCCCEEEECHHHCCCCCCCCCCCCCCCCCCCEEEECCCEEEEEEECCHHHHHHHHH80 (729)
T ss_dssp1ECCEEECCSSSEEEEEEECTTTTTSTTEEEEEEGGGCSSCSBCSTTSCCBSSCCSEECSSCCEEEEEEESSHHHHHHHHH80 (729)
Q ss_pred81------------------------CCCCCCEECCCHHHHHHHCCEEEEEEEEECCEEEEEECCCEEEEEEECCCCCEEEE160 (729)
Q d20181004_281------------------------EGSELKIEKGDPKKLFMEADNKDSGELWHGGQDKFYLETHCTIARDCGDEGDMELF160 (729)
T 2CKJ_A81GVKITYEELPAIITIEDAIKNNSFYGPELKIEKGDLKKGFSEADNVVSGEIYIGGQEHFYLETHCTIAVPKGEAGEMELF160 (729)
T ss_pred81CCCEEEECCCCCCCHHHHHCCCCCCCCCCCCCCCCHHHHHHHCCEEEEEEEEECCCCCCCCCCCEEEEEEECCCCEEEEE160 (729)
T ss_dssp81HCEEEEECCCCCCSSTTTTTTTCCSSSCEEEEESCCSHHHHTCSEEEEEEEEECCBCCCCSSCCEEEEECCCSTTCEEEE160 (729)
Q ss_pred161EECCCHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCCEE240 (729)
Q d20181004_2161SRTQNAMKTDSFAAVMCGVPVNRILVRHARMGVKFKGKETRNGLVSVAEMLYAGKVKHDGYCALDRNEDMLIDGGRHPFL240 (729)
T 2CKJ_A161VSTQNTMKTQSFVAKMLGVPANRIVVRVKRMGGGFGGKETRSTVVSTAVALAAYKTGRPVRCMLDRDEDML