TreeThreader - Results

  Job information

Job ID: d20181003
#Proteins: 4
Protein ID: d20181003_2
Fasta ID: seq2
Submission time: 2018-10-03 10:54:02 +0800
Finished time: 2019-02-17 19:55:26 +0800
Identical Job(s): NULL

  Alignments

1
50
100
150
200
223
2JMU_A 2JMU_A 3BHD_B 3BHD_B 1XP8_A 1XP8_A 2VLD_A 2VLD_A 3CWO_X 3CWO_X 3P96_A 3P96_A 3PZS_A 3PZS_A 2GFG_A 2GFG_A 2DC4_A 2DC4_A 3KFL_A 3KFL_A

  Build multi-template model (choose up to 5 templates)

                   
Download full-length structure

  Top 10 hits

Query:
Job ID  : d20181003_2
Length : 223
Sequence: AQGRIEVPREFAQGYDTEERLQELGAGLYARVTFRDTMYDTDGLSLILSDWWHRQRGDSFWELKCPGVTGTSDWAWEYVE GVSEAAIMAQLFNLGGSVEQKPAGVARSLGSERSLLVASFITKPSCWKLALIGAMGQEPQLRIDEDSADFGYANMVVPAH GHELAEQPTPQEVNYTVQSNLGVPAQEEAPAKLMVYLSVFRPRDYQRLLEAAISGEAIVDSCS

No Hit MAC Score Identity Cols Query HMM Template HMM
12JMU_A143.550.712231-2232-224
23BHD_B120.40.562141-22321-234
31XP8_A47.360.122191-22346-350
42VLD_A43.90.091853-2231-231
53CWO_X43.810.12011-2231-237
63P96_A43.350.122141-2239-316
73PZS_A43.150.092101-2234-288
82GFG_A42.840.131801-2032-193
92DC4_A42.790.131623-2111-165
103KFL_A42.380.092191-223106-420

  Pairwise Query-Template Alignment

No 1
> 2JMU_A        Alignment in PIR format
MAC score = 143.55	Identity = 0.71

Download partial structureDownload full-length structure
Q ss_pred1CCCCEEEEEECCCCCCHHHHHHHHCCEEEEEEEEEEEECCCCCCEEEECCEEEEEECCCEEEEECCCCCCCCCCCCCEEE80 (223)
Q d20181003_21AQGRIEVPREFAQGYDTEERLQELGAGLYARVTFRDTMYDTDGLSLILSDWWHRQRGDSFWELKCPGVTGTSDWAWEYVE80 (223)
T 2JMU_A1AQGLIEVERKFAPGPDTEERLQELGATLEHRVTFRDTYYDTSELSLMLSDHWLRQREGSGWELKCPGVTGVSGPHNEYVE80 (223)
T ss_pred1CCCEEEEEEEEECCHHHHHHHHHCCCCCCCEEEEEEEECCCCCHHHHHCCCEEEEEECCCEEEEEECCCCCCCCCCCCCC80 (223)
T ss_dssp1CSSSEEEEEEEEECTTHHHHHHHHTCEEEEEEEEEEEEEECTTSHHHHTTCEEEEETTTEEEEEECSCSSCCSSCCSCEE80 (223)
Q ss_pred81ECCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCEEEEEEEECEEEEEEECCCCCCCCCEEEECCCCCCCEEEEEECCC160 (223)
Q d20181003_281GVSEAAIMAQLFNLGGSVEQKPAGVARSLGSERSLLVASFITKPSCWKLALIGAMGQEPQLRIDEDSADFGYANMVVPAH160 (223)
T 2JMU_A81VTSEAAIVAQLFELLGSGEQKPAGVAAVLGSLKLQEVASFITTRSSWKLALSGAHGQEPQLTIDLDSADFGYAVGEVEAM160 (223)
T ss_pred81CCCCCCCCCHHHHHCCCCCCCHHHHHHHHHCCCCEEEEEEEEEEEEEEEECCCCCCCCCEEEEEEEECCCCCEEEEEEEE160 (223)
T ss_dssp81ECCHHHHHHHHHHHHTCCSCCCSSHHHHHHHHTCEEEEEEEEEEEEEEEECCSTTSCCCEEEEEEEEETTTEEEEEEEEE160 (223)
Q ss_pred161CCCCCCCCCCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCHHHHHHHHHHHHCCCCCCCCCC223 (223)
Q d20181003_2161GHELAEQPTPQEVNYTVQSNLGVPAQEEAPAKLMVYLSVFRPRDYQRLLEAAISGEAIVDSCS223 (223)
T 2JMU_A161VHEKAEVPAALEKIITVSSMLGVPAQEEAPAKLMVYLQRFRPLDYQRLLEAASSGEATGDSAS223 (223)
T ss_pred161CCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCCCCCCC223 (223)
T ss_dssp161ESCGGGHHHHHHHHHHHHHHHEEECCSSCCCHHHHHHHHHCHHHHHHHHHHSCCCSCCSSCCC223 (223)


No 2
> 3BHD_B        Alignment in PIR format
MAC score = 120.4	Identity = 0.56

Download partial structureDownload full-length structure
Q ss_pred1CCCCEEEEEECCCCCCHHHHHHHHCCEEEEEEEEEEEECCCCCCEEEECCEEEEEECCCEEEEECCCCCCCCCCCCCEEE80 (223)
Q d20181003_21AQGRIEVPREFAQGYDTEERLQELGAGLYARVTFRDTMYDTDGLSLILSDWWHRQRGDSFWELKCPGVTGTSDWAWEYVE80 (223)
T 3BHD_B1AQGLIEVERKFLPGPGTEERLQELGGTLEYRVTFRDTYYDTPELSLMQADHWLRRREDSGWELKCPGAAGVLGPHTEYKE80 (223)
T ss_pred1CCCCEEEEEEEECCHHHHHHHHHCCCCCCCEEEEEEEEECCCCHHHHHCCCEEEEEECCEEEEEEECCCCCCCCCCCCCC80 (223)
T ss_dssp1UCCCEEEEEEECCCTTHHHHHHHTTCEEEEEEEEEEEEEECTTCHHHHTTCEEEEETTTEEEEEEECGGGGTCSSSEEEE80 (223)
Q ss_pred81ECCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCEEEEEEEECEEEEEEECCCCCCCCCEEEECCCCCCCEEEEEECCC160 (223)
Q d20181003_281GVSEAAIMAQLFNLGGSVEQKPAGVARSLGSERSLLVASFITKPSCWKLALIGAMGQEPQLRIDEDSADFGYANMVVPAH160 (223)
T 3BHD_B81LTAEPTIVAQLCKVLRADGLGAGDVAAVLGPLGLQEVASFVTKRSAWKLVLLGADEEEPQLRVDLDTADFGYAVGEVEAL160 (223)
T ss_pred81CCCCCCCCCCCHHHHCCCCCCHHHHHHHHHHCCCEEEEEEEEEEEEEEEECCCCCCCCCEEEEEEEECCCCCCEEEEEEE160 (223)
T ss_dssp81ECCHHHHHHHHHHHTTCCCCCCSCTHHHHTTTTCEEEEEEEEEEEEEEEECTTTCSSSCEEEEEEEEETTSCEEEEEEEE160 (223)
Q ss_pred161CCCCCCCCCCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCHHHHHHHHHHHHCCCCCCCCCC223 (223)
Q d20181003_2161GHELAEQPTPQEVNYTVQSNLGVPAQEEAPAKLMVYLSVFRPRDYQRLLEAAISGEAIVDSCS223 (223)
T 3BHD_B161VHEEAEVPTALEKIHRLSSMLGVPAQETAPAKLIVYLQRFRPQDYQRLLEVNS---------S223 (223)
T ss_pred161ECCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCHHCHHHHHHHHHHHC---------C223 (223)
T ss_dssp161ESSGGGHHHHHHHHHHHHHHHSCCCSSCCCCHHHHHHHHHCHHHHCCUUUUUU---------U223 (223)


No 3
> 1XP8_A    RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1     Alignment in PIR format
MAC score = 47.36	Identity = 0.12

Download partial structureDownload full-length structure
Q ss_pred1CCCCEEEEEECCCCCCHHHHHHHHCCEEEEEEEEEEEECCCCCCEEEECCEEE--EEECCCEEEEECCCCCCCCC-----80 (309)
Q d20181003_21AQGRIEVPREFAQGYDTEERLQELGAGLYARVTFRDTMYDTDGLSLILSDWWH--RQRGDSFWELKCPGVTGTSD-----80 (309)
T 1XP8_A1AESKLDVQVV--ST-GSLSLDLALGVGGIPRGRITEIYGPESGGKTTLALAIVAQAQKAGGTCAFIDAEHALDPVYARAL80 (309)
T ss_pred1CCCCCCCCCC--CC-CCHHHHHHHCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHC80 (309)
T ss_dssp1SCCCCCCCEE--CC-SCHHHHHHTSSSSEETTSEEEEEESTTSSHHHHHHHHHHHHHHTTCCEEEEESSCCCCHHHHHHT80 (309)
Q ss_pred81--C--CCCEEEECCHHHHHHHHHHHCCCCCCCC--CC----------------------CCCCC---------CCCCCCE160 (309)
Q d20181003_281--W--AWEYVEGVSEAAIMAQLFNLGGSVEQKP--AG----------------------VARSL---------GSERSLL160 (309)
T 1XP8_A81GVNTDELLVSQPDNGEQALEIMELLVRSGAIDVVVVDSVAALTPRAEIEGDMGDSLPGLQARLMSQALRKLTAILSKTGT160 (309)
T ss_pred81CCCHHHEEEECCCCHHHHHHHHHHHHHHCCCCEEEECCHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCC160 (309)
T ss_dssp81TCCGGGCEEECCSSHHHHHHHHHHHHTTTCCSEEEEECTTTCCCSTTCUUUUUUUUCCHHHHHHHHHHHHHHHHHTTTCC160 (309)
Q ss_pred161EEEEEEECEEEEEEECC---------CCCCCCCEEEECCCCC--------CCEEEEEECCCCCC-------------CCC240 (309)
Q d20181003_2161VASFITKPSCWKLALIG---------AMGQEPQLRIDEDSAD--------FGYANMVVPAHGHE-------------LAE240 (309)
T 1XP8_A161AAIFINQVREKIGVMYGNPETTTGGRALKFYASVRLDVRKIGQPTKVGNDAVANTVKIKTVKNKVAAPFKEVELALVYGK240 (309)
T ss_pred161EEEEEECCCCCCCCCCCCCCCCCCCCCCHHHCCCHHEEHHCCCCCCCCCCCCCCEEEEEEEECCCCCCCCEEEEEEECCC240 (309)
T ss_dssp161EEEEEEECUUUUUUUUUUUUUUUCHHHHHHHCSEEEEEEEESCCCUUUUUUCEEEEEEEEEEESSSCCCCEEEEEEETTT240 (309)
Q ss_pred241CCCCHHHHHHHHHHCC-CC-C-------CCCC---CHHHHHHHHHCCHHHHHHHHHHHHCCCCCCCCCC309 (309)
Q d20181003_2241QPTPQEVNYTVQSNLG-VP-A-------QEEA---PAKLMVYLSVFRPRDYQRLLEAAISGEAIVDSCS309 (309)
T 1XP8_A241GFDQLSDLVGLAADMDIIKKAGSFYSYGDERIGQGKEKTIAYI-AERPEMEQEIRDRVMAAIRAGNAGE309 (309)
T ss_pred241CCCCCCCHHHHHHHCCCEEECCCEEEECCCEECCCHHHHHHHH-HHCHHHHHHHHHHHHHHHHCCCCCC309 (309)
T ss_dssp241EECHHHHHHHHHHHTTSSEEETTEEESSSSEEEESHHHHHHHH-TTCHHHHHHHHHHHHHHHCUUUUUU309 (309)


No 4
> 2VLD_A    NUCS, UPF0286 protein pyrab01260; endonuclease, hydrolase; 2.60A {Pyrococcus abyssi}     Alignment in PIR format
MAC score = 43.9	Identity = 0.09

Download partial structureDownload full-length structure
Q ss_pred1CCEEEEEECCCC---CCHHHHHHHHCCEEEEEEEEEEEECCCCCCEEEECCEEEEEECCCEEEEECCCCCC----CC---80 (267)
Q d20181003_21GRIEVPREFAQG---YDTEERLQELGAGLYARVTFRDTMYDTDGLSLILSDWWHRQRGDSFWELKCPGVTG----TS---80 (267)
T 2VLD_A1MRKVIIKENPSEEEIKELLDLAEKHGGVVTIFARCKVHYEGRAKSELGEGDRIIIIKPDGSFLIHQNKKREPVNWQPPGS80 (267)
T ss_pred1CCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEEEEEEEEECCCHHHCCCCCCEEEEECCCCCEEECCCCCCCCCCCCCCCC80 (267)
T ss_dssp1CCSEEEESSCCHHHHHHHHHHHHHHTCEEEEEEEEEEEEESSSEEEEEEEEEEEEECTTSCEEEECSSCSSCSEEECTTC80 (267)
Q ss_pred81------------------------CCCCCEEEECC-----------HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCEE160 (267)
Q d20181003_281------------------------DWAWEYVEGVS-----------EAAIMAQLFNLGGSVEQKPAGVARSLGSERSLLV160 (267)
T 2VLD_A81KVTFKENSMISIRRRPYERLEVEIIEPYSLVVFLAEDYEELALTGSEAEMANLIFENP------------------RVIE160 (267)
T ss_pred81CCEEECCEEEEEECCCCCEEEEEEEEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHCH------------------HHHC160 (267)
T ss_dssp81EEEESSEEEEEECSSSCEEEEEEEEEEEEEEEECCCCCCCUUUUUCHHHHHHHHHHCG------------------GGTC160 (267)
Q ss_pred161EEEEEECEEEEEEECCCCCCCCCEEEECCCCCCCEEEEEECCCCCCCCCC-CCCHHHHHHHHHHCCCCCCCCCCHHHHHH240 (267)
Q d20181003_2161ASFITKPSCWKLALIGAMGQEPQLRIDEDSADFGYANMVVPAHGHELAEQ-PTPQEVNYTVQSNLGVPAQEEAPAKLMVY240 (267)
T 2VLD_A161EGFKPIYREKPIR----H---GIVDVMGVDKDGNIVVLELKR-RKADLHAVSQMKRYVDSLKEE----YGENVR--GI-L240 (267)
T ss_pred161CCEEEEEEECCCC----C---CCEEEEEEECCCCEEEEEEEE-CCCCHHHHHHHHHHHHHHHHC----CCCCEE--EE-E240 (267)
T ss_dssp161TTCEEEEEEEEET----T---EEEEEEEECTTSCEEEEEECS-SCBCHHHHHHHHHHHHHHHHH----HCSCEE--EE-E240 (267)
Q ss_pred241HHHCCHHHHHHHHHHHHCCCCCCCCCC267 (267)
Q d20181003_2241LSVFRPRDYQRLLEAAISGEAIVDSCS267 (267)
T 2VLD_A241VAPSLTEGAKKLLEKEG---LEFRKLE267 (267)
T ss_pred241EECCCCHHHHHHHHHCC---CEEEEEC267 (267)
T ss_dssp241EESCBCHHHHHHHHHHT---CEEEECC267 (267)


No 5
> 3CWO_X    Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A     Alignment in PIR format
MAC score = 43.81	Identity = 0.1

Download partial structureDownload full-length structure
Q ss_pred1CCCCEEEEEECCCCCCHHHHHHHHCCEEEEEEEEEEEECCCCCCEEEECCEEEEEECCCEEEEECCCCCCCC-C----CC80 (259)
Q d20181003_21AQGRIEVPREFAQGYDTEERLQELGAGLYARVTFRDTMYDTDGLSLILSDWWHRQRGDSFWELKCPGVTGTS-D----WA80 (259)
T 3CWO_X1MGKRVLIVDDATNGREAVEKYKELKP--D-IVTMDITM--PEMNGIDAIKEIMKIDPNAKIIVCSAMGQQAMVIEAIKAG80 (259)
T ss_pred1CCCEEEEEEECCCHHHHHHHHHCCCC--C-EEEEECCC--CCCCHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHCC80 (259)
T ss_dssp1UCCCEEEEECCCSSSTTHHHHHHHCC--S-CEEEECCS--TTSSHHHHHHHHHHHSSSCCEEEECCSSTHHHHHHHHHTT80 (259)
Q ss_pred81CCEEEECCH----HHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCEEEEEEEECEEEEEEECCCCCCCCCEEEECC-----160 (259)
Q d20181003_281WEYVEGVSE----AAIMAQLFNLGGSVEQKPAGVARSLGSERSLLVASFITKPSCWKLALIGAMGQEPQLRIDED-----160 (259)
T 3CWO_X81AKDFIVNTAAVENPSLITQIAQT--------------FGSQAVVVAIDAKRVDGEFMVF---TYSGKKNTGILLRDWVVE160 (259)
T ss_pred81CCEEEECCCCCCCHHHHHHHHHH--------------HCCCCEEEEEEEEECCCCEEEE---ECCCCCCCCCCHHHHHHH160 (259)
T ss_dssp81CCEEEESHHHHHCTHHHHHHHHH--------------HTGGGEEEEEEEEESSSCEEEE---ETTTTEEEEEEHHHHHHH160 (259)
Q ss_pred161CCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCC---CHH-HHHHHH----------HCC-----HHHHHH240 (259)
Q d20181003_2161SADFGYANMVVPAHGHELAEQPTPQEVNYTVQSNLGVPAQEEA---PAK-LMVYLS----------VFR-----PRDYQR240 (259)
T 3CWO_X161VEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKMEHFLEAFLAGADAALAASVFHFREIDVRELKE240 (259)
T ss_pred161HHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHCCCCEEECCCCCCHHHHHHHHHHCCHHHHHHHHHHHCCCCHHHHHH240 (259)
T ss_dssp161HHHHTCSEEEEEETTTTTCCSCCCHHHHHHHGGGCCSCEEEESCCCSHHHHHHHHHHTCSEEEESHHHHTTSSCHHHHHH240 (259)
Q ss_pred241HHHHHHCCC---CCCCCCC259 (259)
Q d20181003_2241LLEAAISGE---AIVDSCS259 (259)
T 3CWO_X241YLKKHGVNVRLEGLLEHHH259 (259)
T ss_pred241HHHHCCCCEECHHHHHCCC259 (259)
T ss_dssp241HHHTTTCCCCEEEEEEECC259 (259)


No 6
> 3P96_A    Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium}     Alignment in PIR format
MAC score = 43.35	Identity = 0.12

Download partial structureDownload full-length structure
Q ss_pred1CCCCEEEEEECCCCCCHHHHHHHHCCEEEEEEEEEEEECCCCCCEEEECCEEEEEECC--------------CEEEEECC80 (317)
Q d20181003_21AQGRIEVPREFAQGYDTEERLQELGAGLYARVTFRDTMYDTDGLSLILSDWWHRQRGD--------------SFWELKCP80 (317)
T 3P96_A1PKVSVLITVTGVDQPGVTATLFEVLSRHGVELLNVEQVVIRHRLTLGVLVCCPADVADGPALRHDVEAAIRKVGLDVSIE80 (317)
T ss_pred1CCCEEEEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEEEECCEEEEEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEE80 (317)
T ss_dssp1CCEEEEEEEEEECCTTHHHHHHHHHTTTTCEEEEEEEEEETTEEEEEEEEEECHHHHTSHHHHHHHHHHHHHTTCEEEEE80 (317)
Q ss_pred81CCC---CCC--CCCCCEEEE-CCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCEEEEEEEECEEEEEEECCCC-----160 (317)
Q d20181003_281GVT---GTS--DWAWEYVEG-VSEAAIMAQLFNLGGSVEQKPAGVARSLGSERSLLVASFITKPSCWKLALIGAM-----160 (317)
T 3P96_A81RSDDVPIIREPSTHTIFVLGRPITAAAFGAVAREVAALGVNID---------LIRGVSDYPVIGLELRVSVPPGADEALR160 (317)
T ss_pred81ECCCCCCCCCCCCEEEEEEECCCCHHHHHHHHHHHHHCCCCEE---------EEEEECCCCCEEEEEEEECCCCCHHHHH160 (317)
T ss_dssp81ECSSSCSSCCCCSEEEEEEESSCCHHHHHHHHHHHHHTTCEEE---------EEEEEESSSSEEEEEEEECCTTCHHHHH160 (317)
Q ss_pred161-------CCCCCEEEECCC----CCCCEEEEEECCCCCCC-------CCCCCCHHHHHH--------------HHHHCC-240 (317)
Q d20181003_2161-------GQEPQLRIDEDS----ADFGYANMVVPAHGHEL-------AEQPTPQEVNYT--------------VQSNLG-240 (317)
T 3P96_A161TALNRVSSEEHVDVAVEDYTLERRAKRLIVFDVDSTLVQGEVIEMLAAKAGAEGQVAAITDAAMRGELDFAQSLQQRVAT240 (317)
T ss_pred161HHHHHHHHHCCCCEEEECCCCCCCCCEEEEEECCCCCCCCHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHH240 (317)
T ss_dssp161HHHHHHHHHHTCEEEEEECSTTTTCCCEEEECTBTTTBSSCHHHHHHHHTTCHHHHHHHHHHHHTTCSCHHHHHHHHHHT240 (317)
Q ss_pred241---CCC--------CCCCCHHHHHHHHHCC-------------HHHHHHHHHHHHCCC------------CCCCCCC317 (317)
Q d20181003_2241---VPA--------QEEAPAKLMVYLSVFR-------------PRDYQRLLEAAISGE------------AIVDSCS317 (317)
T 3P96_A241LAGLPATVIDEVAGQLELMPGARTTLRTLRRLGYACGVVSGGFRRIIEPLAEELMLDYVAANELEIVDGTLTGRVVG317 (317)
T ss_pred241HCCCCHHHHHHHHHHCCCCCCHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHCCCCCEEEEEEEEECCEEECEECC317 (317)
T ss_dssp241TTTCBTHHHHHHHHHCCBCTTHHHHHHHHHHTTCEEEEEEEEEHHHHHHHHHHTTCSEEEEECEEEETTEEEEEECS317 (317)


No 7
> 3PZS_A    PM kinase, pyridoxamine kinase; structural genomics, center for structural genomics of infec diseases, csgid, transferase; HET: MSE; 1.89A {Yersinia pestis} SCOP: c.72.1.5 PDB: 1td2_A* 1vi9_A*     Alignment in PIR format
MAC score = 43.15	Identity = 0.09

Download partial structureDownload full-length structure
Q ss_pred1CCCCEEEEEECCCCCC----HHHHHHHHCCEEEEEEEEEEEECCCCC---------------------------CEEEEC80 (298)
Q d20181003_21AQGRIEVPREFAQGYD----TEERLQELGAGLYARVTFRDTMYDTDG---------------------------LSLILS80 (298)
T 3PZS_A1MKNILSIQSHVVFGHAGNSAAEFPMRRMGVNVWPLNTVQFSNHTQYGHWTGCVMPASHLTDIVQGIADIDRLKDCDAVLS80 (298)
T ss_pred1CCEEEEEECCCCCCCCCHHHHHHHHHHCCCEEEEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCEEEE80 (298)
T ss_dssp1UCEEEEEEEEESSSCSTHHHHHHHHHHTTCEEEEEEEEEESSCGGGSCCCEEECCHHHHHHHHHHHHHTTCGGGCCEEEE80 (298)
Q ss_pred81CEEEEE----------------ECCCEEEEEC----CC-CCCCCCC---------CCCEEEECCHHHHHHHHHHHCCCCC160 (298)
Q d20181003_281DWWHRQ----------------RGDSFWELKC----PG-VTGTSDW---------AWEYVEGVSEAAIMAQLFNLGGSVE160 (298)
T 3PZS_A81GYIGSPEQGSHILAAVAQVKQANPDAWYFCDPVMGHPEKGCIVAPGVAEFFCNEALPASDMIAPN---LLELEQLSGE--160 (298)
T ss_pred81CCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCEEECHHHHHHHHHHHHHHCCEECCC---HHHHHHHHCC--160 (298)
T ss_dssp81CCCSSHHHHHHHHHHHHHHHHHCTTCEEEECCCCEETTTEECSCHHHHHHHHHTHHHHCSEECCC---HHHHHHHHTS--160 (298)
Q ss_pred161CCCCCCCCCCCCCCCCEEEEEEEECEEEEEEECC-CCCCCCCEEEECCCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHH240 (298)
Q d20181003_2161QKPAGVARSLGSERSLLVASFITKPSCWKLALIG-AMGQEPQLRIDEDSADFGYANMVVPAHGHELAEQPTPQEVNYTVQ240 (298)
T 3PZS_A161-RVEN-VEQA----VQVARSLCARGPKVVLVKHLSRAGYHADCFEMLLVTADDAWHICRPLVDFGKRQPVGVGDLTSGLL240 (298)
T ss_pred161-CCCC-HHHH----HHHHHHHHHHCCCEEEECCCCCCCCCCCEEEEEEEECCCEEEEECCCCCCCCCCCCCHHHHHHHHH240 (298)
T ss_dssp161-CCCS-HHHH----HHHHHHHHTTSCSEEEECCCGGGSSCTTEEEEEEECSSCEEEEEEECCCCTTSCCTTHHHHHHHHH240 (298)
Q ss_pred241HHCCCCCCCCCCHHHHHHHHHCCHHHHHHHH-------------HHHHCCCCCCCCCC298 (298)
Q d20181003_2241SNLGVPAQEEAPAKLMVYLSVFRPRDYQRLL-------------EAAISGEAIVDSCS298 (298)
T 3PZS_A241LVNLLK-GEPLD-KALEHVTAAVYEVMLKTQEMGEYELQVVAAQETIVTPICQFTAVR298 (298)
T ss_pred241HHHHHC-CCCHH-HHHHHHHHHHHHHHHHHHHCCCCCEEEECCHHHHHCCCCCCEEEE298 (298)
T ss_dssp241HHHHHT-TCCHH-HHHHHHHHHHHHHHHHHHHTTCSSCCTTTTHHHHHSCSSCCCCEE298 (298)


No 8
> 2GFG_A    BH2851; antiparallel barrel, structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, unknow function; 2.12A {Bacillus halodurans}     Alignment in PIR format
MAC score = 42.84	Identity = 0.13

Download partial structureDownload full-length structure
Q ss_pred1CCCCEEEEEECCCCCCHH-HHHHHHCCEEEEEEEEEEEECCCCCCEEEEC--CEEEEEEC-CCEEEEECCCCCCCCCCCC80 (215)
Q d20181003_21AQGRIEVPREFAQGYDTE-ERLQELGAGLYARVTFRDTMYDTDGLSLILS--DWWHRQRG-DSFWELKCPGVTGTSDWAW80 (215)
T 2GFG_A1MGKEIEIERKTLVSKETFKRLISQLHIGEGDFKLQRNHYFETDDFQLKKQSSALRIREKEAIFTFTLKQPHPA----GLL80 (215)
T ss_pred1CCCCEEEEEEECCCHHHHHHHHHHHHHCCCCCEEEEEEEEECCCHHHHHCCCEEEEEEECCEEEEEEECCCCC----CCE80 (215)
T ss_dssp1CSEEEEEEEEEEECHHHHHHHHHHTTCCGGGCEEEEEEEEECTTCHHHHTTCEEEEEEETTEEEEEEEEECSS----SEE80 (215)
Q ss_pred81CEEEECCHHHHHHHHHHHCCCCCCCCCCCCCCC-----CCCCCCEEEEEEEECEEEEEEECCCCCCCCCEEEECCCCCC-160 (215)
Q d20181003_281EYVEGVSEAAIMAQLFNLGGSVEQKPAGVARSL-----GSERSLLVASFITKPSCWKLALIGAMGQEPQLRIDEDSADF-160 (215)
T 2GFG_A81ETNQTLSKQE-AKLALESAHF---PSGEVMDALRDLSIPISQLKHIGTLSTSRAEISYE---------QGILCLDHSSYL160 (215)
T ss_pred81EEEEECCHHH-HHHHHHHCCC---CCHHHHHHHHHCCCCHHHEEEEEEEEEEEEEEEEC---------CEEEEEECCEEC160 (215)
T ss_dssp81EEEEEECHHH-HHHHHHHCCC---CCSHHHHHHHHTTCCGGGCEEEEEEEEEEEEEEET---------TEEEEEEEEEET160 (215)
Q ss_pred161--CEEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCHH215 (215)
Q d20181003_2161--GYANMVVPAHGHELAEQPTPQEVNYTVQSNLGVPAQEEAPAKLMVYLSVFRPR215 (215)
T 2GFG_A161GIEDYEIEFEG-----TSEEHATVTFQEILKTFSISQ-VPTENKIQRFFSKKEKN215 (215)
T ss_pred161CCEEEEEEEEE-----CCHHHHHHHHHHHHHHCCCCC-CCCCCHHHHHHHHHHCC215 (215)
T ss_dssp161TEEEEEEEEEE-----SSHHHHHHHHHHHHHHTTCCC-CCCCCHHHHHHHHHCUU215 (215)


No 9
> 2DC4_A    PH1012 protein, 165AA long hypothetical protein; dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.65A {Pyrococcus horikoshii} SCOP: d.63.1.2     Alignment in PIR format
MAC score = 42.79	Identity = 0.13

Download partial structureDownload full-length structure
Q ss_pred1CCEEEEEECCCCCCHHHHHHHHCCEEEEEEEEEEEECCCCCCEEEECCEEEEEECCCEEEEECCCCCCCCCCCCCEEEEC80 (212)
Q d20181003_21GRIEVPREFAQGYDTEERLQELGAGLYARVTFRDTMYDTDGLSLILSDWWHRQRGDSFWELKCPGVTGTSDWAWEYVEGV80 (212)
T 2DC4_A1MEIEVKFRVNF-EDIKRKIEGLGAKFFGIEEQEDVYFELPSPKLLR--VRKINNTGKSYITYKEILDKRNEEFYELEFEV80 (212)
T ss_pred1CEEEEEEEECH-HHHHHHHHHCCCCCCCCEEEEEEEECCCCCCEEE--EEEEECCCEEEEEEEECCCCCCEEEEEEEEEC80 (212)
T ss_dssp1CEEEEEEECCH-HHHHHHHHHHTCEEEEEEEEEEEEECCSTTEEEE--EEEETTTTEEEEEEEEECSSSSCEEEEEEEEB80 (212)
Q ss_pred81C-HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCEEEEEEEECEEEEEEECCCCCCCCCEEEECCCC--CCCEEEEEECC160 (212)
Q d20181003_281S-EAAIMAQLFNLGGSVEQKPAGVARSLGSERSLLVASFITKPSCWKLALIGAMGQEPQLRIDEDSA--DFGYANMVVPA160 (212)
T 2DC4_A81QDPEGAIEL-FKR------L-----------GFKVQGVVKKRRWIYKLN---------NVTFELNRVEKAGDFLDIEVIT160 (212)
T ss_pred81CCHHHHHHH-HHH------C-----------CCEEEEEEEEEEEEEEEC---------CEEEEEEEECCCCCEEEEEEEC160 (212)
T ss_dssp81SCHHHHHHH-HHH------T-----------TCCEEEEEEEEEEEEEET---------TEEEEEEEETTTEEEEEEEECC160 (212)
Q ss_pred161CCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCHHHHHHHHHH212 (212)
Q d20181003_2161HGHELAEQPTPQEVNYTVQSNLGVPAQEEAPAKLMVYLSVFRPRDYQRLLEA212 (212)
T 2DC4_A161S--NP---EEGKKIIWDVARRLGLKEEDVE------------PKLYIELING212 (212)
T ss_pred161C--CH---HHHHHHHHHHHHHCCCCCCCCE------------EHHHHHHHCC212 (212)
T ss_dssp161S--CH---HHHHHHHHHHHHHTTCCGGGBC------------CSCHHHHCCU212 (212)


No 10
> 3KFL_A    Methionyl-tRNA synthetase; parasite, aminoacyl-tRNA synthetase, tRNA ligase metrs, methionine, translation, ATP-binding; HET: ME8; 2.00A {Leishmania major}     Alignment in PIR format
MAC score = 42.38	Identity = 0.09

Download partial structureDownload full-length structure
Q ss_pred1CCCCEEEEEECCCCCC--------HHHHHHHHCCEEEEEEEEEEEECCCCCCEEEECCEEEEEECCCEEEEECCCCCCCC80 (319)
Q d20181003_21AQGRIEVPREFAQGYD--------TEERLQELGAGLYARVTFRDTMYDTDGLSLILSDWWHRQRGDSFWELKCPGVTGTS80 (319)
T 3KFL_A1QEMNYDMNYFIRTTNPTHEKLVQDIWKKLAAKGDIYLGKYEGWYSVS--DESFLTAQNVADGVDRDGKPCKVSLESGHVV80 (319)
T ss_pred1HHCCCCCCCCEECCCHHHHHHHHHHHHHHHHCCCEEEEEEEEEEECC--CCCCCCHHHHHCCCCCCCCEEECCCCCCCCC80 (319)
T ss_dssp1HHTTCCCSEEEETTSHHHHHHHHHHHHHHHHHTCEEEEEEEEEEETT--TTEEECGGGEEEEECTTSCEEEEETTTSCBC80 (319)
Q ss_pred81CCCCCEEEECCHHHHHHHHHHHCCCCCCCCCCCCCC-----C--CCCCCCEEEEEEEECEE--EEEEEC-----------160 (319)
Q d20181003_281DWAWEYVEGVSEAAIMAQLFNLGGSVEQKPAGVARS-----L--GSERSLLVASFITKPSC--WKLALI-----------160 (319)
T 3KFL_A81TWVEEENYMFRLSAFRERLLKYFHDH--PNCIVPEFRRREVIKTVEKGLFDLSISRKRESVMNWSIPVPGDERHCIYVWL160 (319)
T ss_pred81EEEECCHHHHEHHHHHHHHHHHHHHC--CCEECCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCEECCCCCCCEEEEEE160 (319)
T ss_dssp81EEEEEEEEEECGGGGHHHHHHHHHHC--TTSEESHHHHHHHHHHHHHCCCCEECEEEGGGGTTCSCEETTEEEEEECHHH160 (319)
Q ss_pred161-----------CCCCCCCC----------------EEEECC-CC-------------------CCCEEEEEECCCCCC--240 (319)
Q d20181003_2161-----------GAMGQEPQ----------------LRIDED-SA-------------------DFGYANMVVPAHGHE--240 (319)
T 3KFL_A161DALFNYYTGALTRVATDGTETLDEDHHALNRWPADVHVVGKDILKFHAIYWPAFLMSAELPLPERLVSHGWWTKDHKKIS240 (319)
T ss_pred161CCCHHHHHHCCCCCCCCCCCCHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHHHCCCCCCCEEEECCEEEECCCCCC240 (319)
T ss_dssp161HHHTHHHHHHHEEECTTSCEEECSSSTTTTCCSCSEEEEEGGGHHHHHTHHHHHHHHTTCCCCSCEEEECCEEETTEECC240 (319)
Q ss_pred241--CCCCCCCHHHHHHH---------HHHCCCCCCCCC-CHHHHHHHHHCCHHHHHHHHHHHHCCCCCCCCC-------C319 (319)
Q d20181003_2241--LAEQPTPQEVNYTV---------QSNLGVPAQEEA-PAKLMVYLSVFRPRDYQRLLEAAISGEAIVDSC-------S319 (319)
T 3KFL_A241KSLGNAFDPVEKAKEFGIDALKYFLMRESNFQDDGDYSDKNMVARLNGELADTLGNLVSRCVAPKINVNGMWPEPAEYS319 (319)
T ss_pred241CCCCCCCCHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC319 (319)
T ss_dssp241TTTTCCCCHHHHHHHHCHHHHHHHHHHHCCSSCCEECCHHHHHHHHHHTTTTTHHHHHHHHHCTTTSTTSBCCCCCCCC319 (319)