TreeThreader - Results

  Job information

Job ID: d20180929
#Proteins: 4
Protein ID: d20180929_1
Fasta ID: seq1
Submission time: 2018-09-29 10:54:02 +0800
Finished time: 2019-02-17 19:37:52 +0800
Identical Job(s): NULL

  Alignments

1
50
100
149
1SQI_A 1SQI_A 3ISQ_A 3ISQ_A 1T47_A 1T47_A 1TG5_A 1TG5_A 1SP9_A 1SP9_A 3OA4_A 3OA4_A 1SP8_A 1SP8_A 3GM5_A 3GM5_A 3ITW_A 3ITW_A 3RMU_A 3RMU_A

  Build multi-template model (choose up to 5 templates)

                   
Download full-length structure

  Top 10 hits

Query:
Job ID  : d20180929_1
Length : 149
Sequence: GPMPERGRFLHFHSVTFWVGNAKRAADFYCNKDGFESLAEHGLEGGSAFVVSHVIFQGKIVFVLCPALFPWWKEKGDHTV AHGDGVDDHVFDVPDCERIVQCASERWKWYLSEIWVESDKFGNVWFANGQTSYDDTHTLQEHINYTGRN

No Hit MAC Score Identity Cols Query HMM Template HMM
11SQI_A129.210.711491-1498-156
23ISQ_A124.810.661491-1491-149
31T47_A107.970.321491-14912-163
41TG5_A86.90.181461-14915-212
51SP9_A81.110.181461-14936-233
63OA4_A78.980.141434-1491-143
71SP8_A77.110.181461-14921-267
83GM5_A71.690.141371-1439-159
93ITW_A70.990.121297-1491-129
103RMU_A70.320.161327-1421-134

  Pairwise Query-Template Alignment

No 1
> 1SQI_A        Alignment in PIR format
MAC score = 129.21	Identity = 0.71

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCEECCEEEEEEEECCHHHHHHHHHHHCCCEEEEECCCCCCCCEEEEEEEECCEEEEEECCCCCCCCHHHCCHHH80 (149)
Q d20180929_11GPMPERGRFLHFHSVTFWVGNAKRAADFYCNKDGFESLAEHGLEGGSAFVVSHVIFQGKIVFVLCPALFPWWKEKGDHTV80 (149)
T 1SQI_A1GPKPERGRFLHFHSVTFWVGNAKQAASFYCNKMGFEPLAYKGLETGSREVVSHVIKQGKIVFVLCSALNPWNKEMGDHLV80 (149)
T ss_pred1CCCCCCCCCCEEEEEEEECCCHHHHHHHHHHHHCCEEEEEEECCCCCEEEEEEEECCCCEEEEEEECCCCCCCCHHHHHH80 (149)
T ss_dssp1CCCCSSCEEEEEEEEEEECSCHHHHHHHHHHHHCCEEEEEESGGGTCCSEEEEEEEETTEEEEEEEESSTTCHHHHHHHH80 (149)
Q ss_pred81HCCCCCEEEEEECCCHHHHHHHHHHCCCEEEECCEEEECCCCEEEEEEEEECCCCEEEEEECCCCCCCC149 (149)
Q d20180929_181AHGDGVDDHVFDVPDCERIVQCASERWKWYLSEIWVESDKFGNVWFANGQTSYDDTHTLQEHINYTGRN149 (149)
T 1SQI_A81KHGDGVKDIAFEVEDCEHIVQKARERGAKIVREPWVEEDKFGKVKFAVLQTYGDTTHTLVEKINYTGRF149 (149)
T ss_pred81HCCCCEEEEEEEECCHHHHHHHHHHCCCEEEECCCCCCCCCCEEEEEEEECCCCCEEEEEECCCCCCCC149 (149)
T ss_dssp81HHCSEEEEEEEEEECHHHHHHHHHHHTCCEEEEEEEEEETTEEEEEEEEECSTTCEEEEEEEESCCSSS149 (149)


No 2
> 3ISQ_A    4-hydroxyphenylpyruvate dioxygenase; tyrosine metabolism, DIS mutation, iron, mental retardation, metal-binding, oxidored phenylalanine catabolism; 1.75A {Homo sapiens} PDB: 1sqi_A*     Alignment in PIR format
MAC score = 124.81	Identity = 0.66

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCEECCEEEEEEEECCHHHHHHHHHHHCCCEEEEECCCCCCCCEEEEEEEECCEEEEEECCCCCCCCHHHCCHHH80 (149)
Q d20180929_11GPMPERGRFLHFHSVTFWVGNAKRAADFYCNKDGFESLAEHGLEGGSAFVVSHVIFQGKIVFVLCPALFPWWKEKGDHTV80 (149)
T 3ISQ_A1GAKPERGRFLHFHSVTFWVGNAKQAASFYCSKMGFEPLAYRGLETGSREVVSHVIKQGKIVFVLSSALNPWNKEMGDHLV80 (149)
T ss_pred1CCCCCCCCCCCEEEEEEEECCHHHHHHHHHHCCCCEEEEEECCCCCCEEEEEEEEEECCEEEEEECCCCCCCCHHHHHHH80 (149)
T ss_dssp1UCCCSSCEEEEEEEEEEECSCHHHHHHHHHHHHCCEEEEEESGGGTCCSEEEEEEEETTEEEEEEEESSTTCHHHHHHHH80 (149)
Q ss_pred81HCCCCCEEEEEECCCHHHHHHHHHHCCCEEEECCEEEECCCCEEEEEEEEECCCCEEEEEECCCCCCCC149 (149)
Q d20180929_181AHGDGVDDHVFDVPDCERIVQCASERWKWYLSEIWVESDKFGNVWFANGQTSYDDTHTLQEHINYTGRN149 (149)
T 3ISQ_A81KHGDGVKDIAFEVEDCDYIVQKARERGAKIMREPWVEQDKFGKVKFAVLQTYGDTTHTLVEKMNYIGQF149 (149)
T ss_pred81HCCCCEEEEEEECCCHHHHHHHHHHCCCEEEECCCEEECCCCCEEEEEEECCCCCEEEEEECCCCCCCC149 (149)
T ss_dssp81HHCSEEEEEEEEEECHHHHHHHHHHHTCCEEEEEEEEEETTEEEEEEEEECSTTCEEEEEEEESCCSSS149 (149)


No 3
> 1T47_A    4-hydroxyphenylpyruvate dioxygenase; triketone inhibitor, iron, oxidoreductase; HET: NTD; 2.50A {Streptomyces avermitilis} SCOP: d.32.1.3 d.32.1.3     Alignment in PIR format
MAC score = 107.97	Identity = 0.32

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCEECCEEEEEEEECCHHHHHHHHHHHCCCEEEEECCCCCCCCEEEEEEEECCEEEEEECCCCCCCCH---HHCC80 (152)
Q d20180929_11GPMPERGRFLHFHSVTFWVGNAKRAADFYCNKDGFESLAEHGLEGGSAFVVSHVIFQGKIVFVLCPALFPWWK---EKGD80 (152)
T 1T47_A1ARQADPFPVKGMDAVVFAVGNAKQAAHYYSTAFGMQLVAYSGPENGSRETASYVLTNGSARFVLTSVIKPATPWGHFLAD80 (152)
T ss_pred1CCCCCCCCCCCEEEEEEEECCHHHHHHHHHHHCCCEEEEECCCCCCCCCEEEEEEECCCEEEEEEECCCCCCCCHHHHHH80 (152)
T ss_dssp1UUUUCCSCCCEEEEEEEECSCHHHHHHHHHHTSCCEEEEEESGGGTCCSEEEEEEEETTEEEEEEEESSCCSHHHHHHHH80 (152)
Q ss_pred81HHHHCCCCCEEEEEECCCHHHHHHHHHHCCCEEEECCEEEECCCCEEEEEEEEECCCCEEEEEECCCCCCCC152 (152)
Q d20180929_181HTVAHGDGVDDHVFDVPDCERIVQCASERWKWYLSEIWVESDKFGNVWFANGQTSYDDTHTLQEHINYTGRN152 (152)
T 1T47_A81HVAEHGDGVVDLAIEVPDARAAHAYAIEHGARSVAEPYELKDEHGTVVLAAIATYGKTRHTLVDRTGYDGPY152 (152)
T ss_pred81HHHHCCCEEEEEEEECCCHHHHHHHHHHCCCEECCCCCCCCCCCCCEEEEEEECCCCCEEEEEECCCCCCCC152 (152)
T ss_dssp81HHHHHCSEEEEEEEECSCHHHHHHHHHHTTCCEEEEEEEEEETTEEEEEEEEECSTTCEEEEEEEEEECSSS152 (152)


No 4
> 1TG5_A        Alignment in PIR format
MAC score = 86.9	Identity = 0.18

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCEECCEEEEEEEECCHHHHHHHHHHHCCCEEEEECCCCCCCCEEEEEEEECCEEEEEECCCCCCCC--------80 (201)
Q d20180929_11GPMPERGRFLHFHSVTFWVGNAKRAADFYCNKDGFESLAEHGLEGGSAFVVSHVIFQGKIVFVLCPALFPWW--------80 (201)
T 1TG5_A1NPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGNMVHASYLLTSGDLRFLFTAPYSPSLSAGEIKPT80 (201)
T ss_pred1CCCCCCCCCCEEEEEEEECCCHHHHHHHHHHHHCCEEEEEECCCCCCEEEEEEEEECCCEEEEEECCCCCCCCCCCCCCC80 (201)
T ss_dssp1CCCCCSSCEEEEEEEEEECSCHHHHHHHHHHHHTCEEEEEESGGGTCSSEEEEEEEETTEEEEEEEECCGGGGTTCCGGG80 (201)
Q ss_pred81----------HHHCCHHHHCCCCCEEEEEECCCHHHHHHHHHHCCCEEEECCEEEECCCCEEEEEEEEECCCCEEEEEEC160 (201)
Q d20180929_181----------KEKGDHTVAHGDGVDDHVFDVPDCERIVQCASERWKWYLSEIWVESDKFGNVWFANGQTSYDDTHTLQEH160 (201)
T 1TG5_A81TTASIPSFDHGSCRSFFSSHGLGVRAVAIEVEDAESAFSISVANGAIPSSPPI--VLN-EAVTIAEVKLYGDVVLRYVSY160 (201)
T ss_pred81CCCCCCCCCCCCCCCCCHHCCCCEEEEEEEECCHHHHHHHHHHCCCEEEECCC--CCC-CCEEEEEEECCCCCEEEEEEC160 (201)
T ss_dssp81CCCSSTTCCHHHHHHHHHHHCSEEEEEEEEESCHHHHHHHHHHTTCCEEEEEE--EET-TTEEEEEEEEETTEEEEEEEE160 (201)
Q ss_pred161CCC----------------------------------CCCC201 (201)
Q d20180929_1161INY----------------------------------TGRN201 (201)
T 1TG5_A161KAEDTEKSEFLPGFERVEDASSFPLDYGIRRLDHAVGNVPE201 (201)
T ss_pred161CCCCCCCCCCCCCCEECCCCCCCCCCCCCCCEEEEEEECCC201 (201)
T ss_dssp161CCUUUUUCCCSTTCEECCSTTSCCCCCSEEEEEEEEEECSC201 (201)


No 5
> 1SP9_A        Alignment in PIR format
MAC score = 81.11	Identity = 0.18

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCEECCEEEEEEEECCHHHHHHHHHHHCCCEEEEECCCCCCCCEEEEEEEECCEEEEEECCCCCC----------80 (201)
Q d20180929_11GPMPERGRFLHFHSVTFWVGNAKRAADFYCNKDGFESLAEHGLEGGSAFVVSHVIFQGKIVFVLCPALFP----------80 (201)
T 1SP9_A1NPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGNMVHASYLLTSGDLRFLFTAPYSPSLSAGEIKPT80 (201)
T ss_pred1CCCCCCCCCCEEEEEEEECCCHHHHHHHHHHHHCCEEEEEECCCCCCEEEEEEEECCCCEEEEEECCCCCCCCCCCCCCC80 (201)
T ss_dssp1CCCCCSSCCCCEEEEEEECSCHHHHHHHHHHHTTCEEEEECSTTTTCSSEEEEEEEETTEEEEEEEECCCCUUUUUUUUU80 (201)
Q ss_pred81--------CCHHHCCHHHHCCCCCEEEEEECCCHHHHHHHHHHCCCEEEECCEEEECCCCEEEEEEEEECCCCEEEEEEC160 (201)
Q d20180929_181--------WWKEKGDHTVAHGDGVDDHVFDVPDCERIVQCASERWKWYLSEIWVESDKFGNVWFANGQTSYDDTHTLQEH160 (201)
T 1SP9_A81TTASIPSFDHGSCRSFFSSHGLGVRAVAIEVEDAESAFSISVANGAIPSSPPI--VLN-EAVTIAEVKLYGDVVLRYVSY160 (201)
T ss_pred81CCCCCCCCCCCCCCCCHHCCCCCEEEEEEEECCHHHHHHHHHHCCCEEEECCC--CCC-CCEEEEEEECCCCCEEEEEEC160 (201)
T ss_dssp81UCCSSTTCCHHHHHHHHHHHCSCEEEEEEECSCHHHHHHHHHHTTCCEEEEEE--EET-TTEEEEEEEEETTEEEEEEEC160 (201)
Q ss_pred161CC-----------C-----------------------CCCC201 (201)
Q d20180929_1161IN-----------Y-----------------------TGRN201 (201)
T 1SP9_A161KAEDTEKSEFLPGFERVEDASSFPLDYGIRRLDHAVGNVPE201 (201)
T ss_pred161CCCCCCCCCCCCCCEECCCCCCCCCCCCCCCEEEEEEECCC201 (201)
T ss_dssp161CUUUUUUUUCCTTCEECCUUUUUCCCSSEEEEEEEEEECSC201 (201)


No 6
> 3OA4_A    Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans}     Alignment in PIR format
MAC score = 78.98	Identity = 0.14

Download partial structureDownload full-length structure
Q ss_pred1CCCCEECCEEEEEEEECCHHHHHHHHHHHCCCEEEEECCCCCCCCEEEEEEEECCEEEEEECCCCCCCCHHHCCHHHHCC80 (146)
Q d20180929_11PERGRFLHFHSVTFWVGNAKRAADFYCNKDGFESLAEHGLEGGSAFVVSHVIFQGKIVFVLCPALFPWWKEKGDHTVAHG80 (146)
T 3OA4_A1VMAEKSNKLDHIGIAVTSIKDVLPFYVGSLKLKLLGMEDLPS--QGVKIAFLEIGESKIELLEPLSEE-SPIAKFIQKRG80 (146)
T ss_pred1CCEEECCCCCEEEEEECCHHHHHHHHHHHCCCCEEECCCCCC--CCEEEEEEECCCEEEEEEEECCCC-CCHHHHHHCCC80 (146)
T ss_dssp1UUUUCCCEEEEEEEECSCHHHHHHHHHHTSCCEEEEEEEEGG--GTEEEEEEEETTEEEEEEEESSTT-SHHHHHHHHHC80 (146)
Q ss_pred81CCCEEEEEECCCHHHHHHHHHHCCCEEEECCEEEECCCCEEEEEEEEECCCCEEEEEECCCCCCCC146 (146)
Q d20180929_181DGVDDHVFDVPDCERIVQCASERWKWYLSEIWVESDKFGNVWFANGQTSYDDTHTLQEHINYTGRN146 (146)
T 3OA4_A81EGIHHIAIGVKSIEERIQEVKENGVQMINDEPVPGARGAQVAFLHPRSARGVLYEFCEKKEQAENL146 (146)
T ss_pred81CCCCEEEEECCCHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEEECCCCCCEEEEEEECCCCHHHH146 (146)
T ss_dssp81SEEEEEEEECSCHHHHHHHHHHTTCCBSCSSCEECGGGCEEEEBCGGGTTTCCEEEEECCCCCCCU146 (146)


No 7
> 1SP8_A    4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 2.00A {Zea mays} SCOP: d.32.1.3 d.32.1.3     Alignment in PIR format
MAC score = 77.11	Identity = 0.18

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCEECCEEEEEEEECCHHHHHHHHHHHCCCEEEEECCCCCCCCEEEEEEEECCEEEEEECCCCCCCC--------80 (250)
Q d20180929_11GPMPERGRFLHFHSVTFWVGNAKRAADFYCNKDGFESLAEHGLEGGSAFVVSHVIFQGKIVFVLCPALFPWW--------80 (250)
T 1SP8_A1NPRSDRFHTLAFHHVELWCADAASAAGRFSFGLGAPLAARSDLSTGNSAHASLLLRSGSLSFLFTAPYAHGADAATAALP80 (250)
T ss_pred1CCCCCCCCCCEEEEEEEEECCHHHHHHHHHHHCCCEEEEEECCCCCCCCEEEEEEEECCEEEEEECCCCCCCCCCCCCCC80 (250)
T ss_dssp1CCCCCSSCEEEEEEEEEECSCHHHHHHHHHHHHTCCEEEEESGGGTCCSEEEEEEEETTEEEEEEEECCSSCCGGGCSST80 (250)
Q ss_pred81----HHHCCHHHHCCCCCEEEEEECCCHHHHHHHHHHCCCEEEECCEEEECCCCEEEEEEEEECCCCEEEEEEC------160 (250)
Q d20180929_181----KEKGDHTVAHGDGVDDHVFDVPDCERIVQCASERWKWYLSEIWVESDKFGNVWFANGQTSYDDTHTLQEH------160 (250)
T 1SP8_A81SFSAAAARRFAADHGLAVRAVALRVADAEDAFRASVAAGARPAFGPVD-LGRG--FRLAEVELYGDVVLRYVSYPDGAAG160 (250)
T ss_pred81CCCHHHHHHHHHHCCCEEEEEEEEECCHHHHHHHHHHCCCEEECCCEE-CCCC--EEEEEEECCCCCEEEEEECCCCCCC160 (250)
T ss_dssp81TCCHHHHHHHHHHHSSEEEEEEEEESCHHHHHHHHHTTTCCEEEEEEE-EETT--EEEEEEEEETTEEEEEEECCTTGGG160 (250)
Q ss_pred161--------------------------------------------------------------------------------240 (250)
Q d20180929_1161--------------------------------------------------------------------------------240 (250)
T 1SP8_A161EPFLPGFEGVASPGAADYGLSRFDHIVGNVPELAPAAAYFAGFTGFHEFAEFTTEDVGTAESGLNSMVLANNSENVLLPL240 (250)
T ss_pred161CCCCCCCCCCCCCCCCCCCCCEEEEEEEEECCHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCEEEEEECCCCCEEEEE240 (250)
T ss_dssp161SSSSTTCEECCCTTCCCCSEEEEEEEEEECSCHHHHHHHHHHHHCCEEEEEEECUUUUUUUUCEEEEEEECSSSCCEEEE240 (250)
Q ss_pred241---CCCCCCC250 (250)
Q d20180929_1241---INYTGRN250 (250)
T 1SP8_A241NEPVHGTKRR250 (250)
T ss_pred241CCCCCCCCCC250 (250)
T ss_dssp241EEECCCSSSC250 (250)


No 8
> 3GM5_A    Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis}     Alignment in PIR format
MAC score = 71.69	Identity = 0.14

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCEECCEEEEEEEECCHHHHHHHHHHHCCCEEEEECCCC------------CCCCEEEEEEEECCEEEEEECCCC80 (157)
Q d20180929_11GPMPERGRFLHFHSVTFWVGNAKRAADFYCNKDGFESLAEHGLE------------GGSAFVVSHVIFQGKIVFVLCPAL80 (157)
T 3GM5_A1SMSKNILDMRNTVQIGIVVRDIEESLQNYAEFFGVEKPQWFWTDDYSKAHTKFNGRPTKARAKLAFFELGPLQLELIEPD80 (157)
T ss_pred1CCCCCCCCCCCEEEEEEECCCHHHHHHHHHHHCCCCCCEEEECCCCCCCCCEEECCCCCCEEEEEEEEECCEEEEEECCC80 (157)
T ss_dssp1CCCSSCCCGGGCEEEEEECSCHHHHHHHHHHHTTCCCCCCEECCCHHHHCCEETTEECCCCEEEEEEEETTEEEEEEEEC80 (157)
Q ss_pred81CCCCHHHCCHHHHCCCCCEEEEEECCCHHHHHHHHHHCCCEEEECCEEEECCCCEEEEEEEEE--CCCCEEEEEECC157 (157)
Q d20180929_181FPWWKEKGDHTVAHGDGVDDHVFDVPDCERIVQCASERWKWYLSEIWVESDKFGNVWFANGQT--SYDDTHTLQEHI157 (157)
T 3GM5_A81-ENPSTWREFLDKNGEGIHHIAFVVKDMDRKVEELYRKGMKVIQKGD---FEGGR--YAYIDTLRALKVMIELLENY157 (157)
T ss_pred81-CCCCHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHCCCCEEEECC---CCCCE--EEEEECCCCCCEEEEEEECC157 (157)
T ss_dssp81-SSSCHHHHHHHHHCSEEEEEEEECSCHHHHHHHHHHTTCCEEEEEE---ETTEE--EEEESCHHHHSSEEEEEEEC157 (157)


No 9
> 3ITW_A    Protein TIOX; bleomycin resistance fold, bisintercalator, solvent-exposed residue, thiocoraline, protein binding, peptide binding Pro; 2.15A {Micromonospora SP}     Alignment in PIR format
MAC score = 70.99	Identity = 0.12

Download partial structureDownload full-length structure
Q ss_pred1CEECCEEEEEEEECCHHHHHHHHHHHCCCEEEEECCCCCCCCEEEEEEEECCEEEEEECCCCCCCCHHHCCHHHHCCCCC80 (143)
Q d20180929_11GRFLHFHSVTFWVGNAKRAADFYCNKDGFESLAEHGLEGGSAFVVSHVIFQGKIVFVLCPALFPWWKEKGDHTVAHGDGV80 (143)
T 3ITW_A1G---SHMVVELAYTDPDRAVDWLVRVFGFRLLLRQPAI---GTIRHADLDTGGGIVMVRRTGEPYTVS-----CAGGHTC80 (143)
T ss_pred1C---CCEEEEEEECCHHHHHHHHHHHCCCEEEEEECCC---CCEEEEEEEECCEEEEEEECCCCCCCC-----CCCCCCE80 (143)
T ss_dssp1C---CCCEEEEEESCHHHHHHHHHHHHCCEEEEEESSS---SSCSEEEEECSSSEEEEEETTCCSSCE-----ECCCCCC80 (143)
Q ss_pred81EEEEEECCCHHHHHHHHHHCCCEEEECCEEEECCCCEEEEEEEEECCCCEEEEEECCCCCCCC143 (143)
Q d20180929_181DDHVFDVPDCERIVQCASERWKWYLSEIWVESDKFGNVWFANGQTSYDDTHTLQEHINYTGRN143 (143)
T 3ITW_A81KQVIVWVSDVDEHFMRSTAAGADIVQPLQDKPW---GLRQYLVRDLEGHLWEFTRHLRDVPPR143 (143)
T ss_pred81EEEEEEECCHHHHHHHHHHCCCEEEECCCCCCC---CCEEEEEECCCCCEEEEEEECCCCCHH143 (143)
T ss_dssp81CEEEEEESCHHHHHHHHHHTTCEEEEEEEEETT---TEEEEEEECSSSCEEEEEECCUUUUUU143 (143)


No 10
> 3RMU_A    Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} SCOP: d.32.1.0     Alignment in PIR format
MAC score = 70.32	Identity = 0.16

Download partial structureDownload full-length structure
Q ss_pred1CEECCEEEEEEEECCHHHHHHHHHHHCCCEEEEECCCCCCCCEEEEEEEECCEEEEEECCCCCCCCHHHCCHHHHC-CCC80 (138)
Q d20180929_11GRFLHFHSVTFWVGNAKRAADFYCNKDGFESLAEHGLEGGSAFVVSHVIFQGKIVFVLCPALFPWWKEKGDHTVAH-GDG80 (138)
T 3RMU_A1SMLGRLNHVAIAVPDLEKAAAFYKNILGAQVSEAVPL--PEHGVSVVFVNLGNTKMELLHPLGLDS-PIAGFLQKNKAGG80 (138)
T ss_pred1CCCCCEEEEEEEECCHHHHHHHHHHHHCCEEEEEEEC--CCCCEEEEEEECCCEEEEEEEECCCCC-CHHHHHHHCCCCC80 (138)
T ss_dssp1CCEEEEEEEEEECSCHHHHHHHHHHTSCCEECCCEEE--GGGTEEEEEEECSSSEEEEEEECSTTC-TTHHHHHHCTTCE80 (138)
Q ss_pred81CEEEEEECCCHHHHHHHHHHCCCEEEECCEEEECCCCEEEEEEEE-ECCCCEEEEEEC138 (138)
Q d20180929_181VDDHVFDVPDCERIVQCASERWKWYLSEIWVESDKFGNVWFANGQ-TSYDDTHTLQEH138 (138)
T 3RMU_A81MHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGA-HGKPVIFLHPKDCGGVLVELEQA138 (138)
T ss_pred81CCEEEEEECCHHHHHHHHHHCCCEEECCCCCCCC-CCCEEEEEEEECCCCEEEEEECC138 (138)
T ss_dssp81EEEEEEEESCHHHHHHHHHHTTCTTBCCCCEECT-TSSEEEEECSCSSCCSCEEEEEC138 (138)