TreeThreader - Results

  Job information

Job ID: d20180925
#Proteins: 4
Protein ID: d20180925_2
Fasta ID: seq2
Submission time: 2018-09-25 10:54:02 +0800
Finished time: 2019-02-17 19:20:57 +0800
Identical Job(s): NULL

  Alignments

1
50
100
150
200
250
298
1Z3I_X 1Z3I_X 1Z6A_A 1Z6A_A 3MWY_W 3MWY_W 3DMQ_B 3DMQ_B 3LY5_A 3LY5_A 2PL3_A 2PL3_A 4A36_B 4A36_B 3FHC_B 3FHC_B 3II0_A 3II0_A 2GXS_A 2GXS_A

  Build multi-template model (choose up to 5 templates)

                   
Download full-length structure

  Top 10 hits

Query:
Job ID  : d20180925_2
Length : 298
Sequence: LGLRRALPPKFRKDKFEDDAPVLKEPPANCTHDLIKADKEALRVHVCVAPVKSLVSRRHQRGGVKFLWWPHTFRGIENSK VCIMADEMGIQKTLMCITLIWPLLKQSADCGPEIDKKWVVPPSHLNGNQYNEVGKWLGGDVQGVAIDGIDKDNEDSKCVN QIPMQGMRWPTPIYIINYETFRNHAEVLCKGKQGLWICREGHSKKDSDFHTYCALPTMNNQRRVDISGTPPQNDLLGYWS LVEHQQSSPLGTHQEWGHRFEIPNLKGRDADAPDKDRGAGTFKYQHCISIVNWAYCHE

No Hit MAC Score Identity Cols Query HMM Template HMM
11Z3I_X219.170.672981-2981-298
21Z6A_A131.570.162421-2981-247
33MWY_W116.840.172881-298146-494
43DMQ_B86.880.122851-2985-423
53LY5_A70.730.12301-2721-262
62PL3_A68.390.112111-27610-236
74A36_B67.670.1222949-2981-253
83FHC_B66.060.082272-2691-235
93II0_A65.810.082871-2981-333
102GXS_A65.230.1320318-2721-207

  Pairwise Query-Template Alignment

No 1
> 1Z3I_X    Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19     Alignment in PIR format
MAC score = 219.17	Identity = 0.67

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCEEEECCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCC80 (298)
Q d20180925_21LGLRRALPPKFRKDKFEDDAPVLKEPPANCTHDLIKADKEALRVHVCVAPVKSLVSRRHQRGGVKFLWWPHTFRGIENSK80 (298)
T 1Z3I_X1LGLRRAGVRKALHDPFEDGALVLYEPPAISAHDLIKADKEKLPVHVVVDPVLSKVLRPHQREGVKFLWDCVTGRRIENSY80 (298)
T ss_pred1CCCCCCCCCCCCCCCCCCCCEECCCCCCCCHHHHHCCCCCCCCCCEEECHHHCCCCHHHHHHHHHHHHHHHHCCCCCCCC80 (298)
T ss_dssp1CCSSCSSSCCCSSCTTSTTCCEEECCCCCCHHHHHHSCGGGSCCCEECCHHHHTTCCHHHHHHHHHHHHHHTTSSSTTCC80 (298)
Q ss_pred81CCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHH160 (298)
Q d20180925_281VCIMADEMGIQKTLMCITLIWPLLKQSADCGPEIDKKWVVPPSHLNGNQYNEVGKWLGGDVQGVAIDGIDKDNEDSKCVN160 (298)
T 1Z3I_X81GCIMADEMGLGKTLQCITLIWTLLKQSPDCKPEIDKVIVVSPSSLVRNWYNEVGKWLGGRVQPVAIDGGSKDEIDSKLVN160 (298)
T ss_pred81CEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCEEEECCHHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHH160 (298)
T ss_dssp81EEEECCCTTSCHHHHHHHHHHHHHHCCTTSSCSCSCEEEEECHHHHHHHHHHHHHHHGGGCCEEEECSSCHHHHHHHHHH160 (298)
Q ss_pred161CCCCCCCCCCCCEEEEEHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCHHHHHHHCCCCCCEEEEECCCCCCCHHHHHH240 (298)
Q d20180925_2161QIPMQGMRWPTPIYIINYETFRNHAEVLCKGKQGLWICREGHSKKDSDFHTYCALPTMNNQRRVDISGTPPQNDLLGYWS240 (298)
T 1Z3I_X161FISQQGMRIPTPILIISYETFRLHAEVLHKGKVGLVICDEGHRLKNSDNQTYLALNSMNAQRRVLISGTPIQNDLLEYFS240 (298)
T ss_pred161HHHHCCCCCCCCEEEECHHHHHHHHHHHHCCCCCEEEEECCHHHCCCHHHHHHHHHHHHHCEEEEECCCCCCCCHHHHHH240 (298)
T ss_dssp161HHCCCSSCCSCCEEEEEHHHHHHHTTTTTTSCCCEEEETTGGGCCTTCHHHHHHHHHHCCSEEEEECSSCSGGGGGGCHH240 (298)
Q ss_pred241HHHHHCCCCCCCHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCC298 (298)
Q d20180925_2241LVEHQQSSPLGTHQEWGHRFEIPNLKGRDADAPDKDRGAGTFKYQHCISIVNWAYCHE298 (298)
T 1Z3I_X241LVHFVNSGILGTAQEFKKRFEIPILKGRDADASDKDRAAGEQKLQELISIVNRCLIRR298 (298)
T ss_pred241HHHHHCCCCCCCHHHHHHHHCCHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHC298 (298)
T ss_dssp241HHHHHHHHHHCCHHHHHHHTHHHHHHHHSTTCCSHHHHHHHHHHHHHHHHHHHHEECC298 (298)


No 2
> 1Z6A_A        Alignment in PIR format
MAC score = 131.57	Identity = 0.16

Download partial structureDownload full-length structure
Q ss_pred1C---CCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCEEEECCCCCCCCCHHHHHHHHHHHHCCCCCC80 (303)
Q d20180925_21L---GLRRAL--PPKFRKDKFEDDAPVLKEPPANCTHDLIKADKEALRVHVCVAPVKSLVSRRHQRGGVKFLWWPHTFRG80 (303)
T 1Z6A_A1MGSSHHHHHHSSGLVP--------RG--SHMASK-------S-FQL--LE--PY-NIKANLRPYQIKGFSWMRFMN----80 (303)
T ss_pred1CCHHHHHHHHHHHHHH--------HH--CCCCCC-------C-CCC--CC--CC-CCCCEECHHHHHHHHHHHHHH----80 (303)
T ss_dssp1UUUUUUUUUUUUUCCC--------CB--CCSCTT-------S-SCC--CC--CC-SCSSCCCHHHHHHHHHHHHHH----80 (303)
Q ss_pred81CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHCCCCCCEEEEECCCCCCCH160 (303)
Q d20180925_281IENSKVCIMADEMGIQKTLMCITLIWPLLKQSADCGPEIDKKWVVPPSHLNGNQYNEVGKWLGGDVQGVAIDGIDKDNED160 (303)
T 1Z6A_A81-KLGFGICLADDMGLGKTLQTIAVFSDAKK-E---N-ELTPSLVICPLSVLKNWEEELSKFAPH-LRFAVFHEDRSK---160 (303)
T ss_pred81-HCCCCEEECCCCCCCCHHHHHHHHHHHHH-C---C-CCCCEEEEEECCHHHHHHHHHHHHCCC-CEEEEEECCHHH---160 (303)
T ss_dssp81-HTTCCEEECCCTTSCHHHHHHHHHHHTTT-T---T-CCSSEEEECCHHHHHHHHHHHHHHCTT-SCEEECCSSCCS---160 (303)
Q ss_pred161HHHHHCCCCCCCCCCCCEEEEEHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCHHHHHHHCCCCCCEEEEECCCCCCCH240 (303)
Q d20180925_2161SKCVNQIPMQGMRWPTPIYIINYETFRNHAEVLCKGKQGLWICREGHSKKDSDFHTYCALPTMNNQRRVDISGTPPQNDL240 (303)
T 1Z6A_A161IKL-E---------DYDIILTTYAVLLRD-TRLKEVEWKYIVIDEAQNIKNPQTKIFKAVKELKSKYRIALTGTPIENKV240 (303)
T ss_pred161HHH-C---------CCCEEEECHHHHHHH-HHHCCCCCCEEEEECHHHCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCH240 (303)
T ss_dssp161CCG-G---------GSSEEEECSHHHHSC-CTTTTSCCSEEEEECCSCCSCCCSHHHHHHTTSCCSEEEEECSCCCTTTH240 (303)
Q ss_pred241HHHHHHHHHHCCCCCCCHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCC303 (303)
Q d20180925_2241LGYWSLVEHQQSSPLGTHQEWGHRFEIPNLKGRDADAPDKDRGAGTFKYQHCISIVNWAYCHE303 (303)
T 1Z6A_A241DDLWSIMTFLNPGLLGSYSEFKSKFATPIKK-----GDNMAKEELKAIISP---FILRRTKYD303 (303)
T ss_pred241HHHHHHHHHHCCCCCCCHHHHHHHHHHHHCC-----CCHHHHHHHHHHHHH---HHHHHHCCH303 (303)
T ss_dssp241HHHHHHHHHHSTTTTCCHHHHHHHTHHHHHT-----TCHHHHHHHHHHHGG---GEEBCCTTC303 (303)


No 3
> 3MWY_W    Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: AGS; 3.70A {Saccharomyces cerevisiae}     Alignment in PIR format
MAC score = 116.84	Identity = 0.17

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCC-CCCCCCCC-CCCCCC--CCC-----CCCCCCCHHHH-------HHCCCCCCCEEEEC---------------80 (359)
Q d20180925_21LGLRRAL-PPKFRKDK-FEDDAP--VLK-----EPPANCTHDLI-------KADKEALRVHVCVA---------------80 (359)
T 3MWY_W1HVPERIIDSQRASLEDGTSQLQYLVKWRRLNYDEATWENATDIVKLAPEQVKHFQNRENSKILPQYSSNYTSQRPRFEKL80 (359)
T ss_pred1HHHHHEEEECCCCCCCCCCCEEEEEEECCCCCCCEEECCHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHCCCCCCCCCCC80 (359)
T ss_dssp1TCEEEECCCCCEECTTSCEECBCCEEETTSCSTTCBCCBHHHHTTTCHHHHHHHHHTTTCTTCSTTCCCCCSCCCCCCCC80 (359)
Q ss_pred81-----CCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCEEEECCCC160 (359)
Q d20180925_281-----PVKSLVSRRHQRGGVKFLWWPHTFRGIENSKVCIMADEMGIQKTLMCITLIWPLLKQSADCGPEIDKKWVVPPSH160 (359)
T 3MWY_W81SVQPPFIKGGELRDFQLTGINWMAFLWS-----KGDNGILADEMGLGKTVQTVAFISWLIFARR----QNGPHIIVVPLS160 (359)
T ss_pred81CCCCCCCCCCCCCHHHHHHHHHHHHHHH-----CCCCEEEEECCCCCHHHHHHHHHHHHHHHCC----CCCCEEEEECHH160 (359)
T ss_dssp81SSCCTTCCSSCCCTHHHHHHHHHHHHHT-----TTCCEEECCCTTSSTTHHHHHHHHHHHHHHS----CCSCEEEECCTT160 (359)
Q ss_pred161CCHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHCCCCC----CCCCCCCEEEEEHHHHHHHHHHHHCCCCCEEEECC240 (359)
Q d20180925_2161LNGNQYNEVGKWLGGDVQGVAIDGIDKDNEDSKCVNQIPMQ----GMRWPTPIYIINYETFRNHAEVLCKGKQGLWICRE240 (359)
T 3MWY_W161TMPAWLDTFEKWAPDL-NCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDE240 (359)
T ss_pred161HHHHHHHHHHHHCCCC-EEEEEECCHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEECHHHHHHHHHHHHCCCCCEEEEEC240 (359)
T ss_dssp161THHHHHHHHHHHSTTC-CEEECCCSSHHHHHHHHHHSCSCCUUUUUCCCCCSEEEECTTHHHHTHHHHHTSEEEEEEETT240 (359)
Q ss_pred241CCCCCCCCCHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCC---------CCC---HHHHHH----HCCCCC320 (359)
Q d20180925_2241GHSKKDSDFHTYCALPTMNNQRRVDISGTPPQNDLLGYWSLVEHQQSSP---------LGT---HQEWGH----RFEIPN320 (359)
T 3MWY_W241AHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEEYIHDLHRRIQPFI320 (359)
T ss_pred241CCCCCCHHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHHHHCCCCCCCHHHHCCCCCCHHHHHHHHHHHHHHHHHH320 (359)
T ss_dssp241GGGGCCSSSHHHHHHTTSEEEEEEEECSCCCSSCSHHHHHHHHHHCSCCCUUUUUUUUUCCTTHHHHHHHHHHHTTGGGE320 (359)
Q ss_pred321CCCC----CCCCCHHHHHHHHH-HHHHHHHHHHHHHHCC359 (359)
Q d20180925_2321LKGR----DADAPDKDRGAGTF-KYQHCISIVNWAYCHE359 (359)
T 3MWY_W321LRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKN359 (359)
T ss_pred321HHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHH359 (359)
T ss_dssp321EECCGGGGTTTSCCEEEEEEEECCCHHHHHHHHHHHHHC359 (359)


No 4
> 3DMQ_B        Alignment in PIR format
MAC score = 86.88	Identity = 0.12

Download partial structureDownload full-length structure
Q ss_pred1CC---CCCC-----------C---------CC-CCCCCCCCCCCCCCCCCC---------CCCCHHHHHHCCCCC--CCE80 (432)
Q d20180925_21LG---LRRA-----------L---------PP-KFRKDKFEDDAPVLKEPP---------ANCTHDLIKADKEAL--RVH80 (432)
T 3DMQ_B1LGQRWISDTESELGLGTVVAVDARTVTLLFPSTGENRLYARSDSPVTRVMFNPGDTITSHDGWQMQVEEVKEENGLLTYI80 (432)
T ss_pred1CCCCCCCCCCCCCCCCEEEEECCEEEEEECCCCCHHHHHHHCCCCCEEEECCCCCEEECCCCCEEEEEECCCCCCEEEEE80 (432)
T ss_dssp1TTCEEEESSCGGGCEEEEEEECSSEEEEEETTTTEEEEEETTTCCEEECCCCTTCEEEBTTSCEEEEEEEEESSSCEEEE80 (432)
Q ss_pred81EEEC----------------CCCC---C------CCCHHHHH--HHHHHHHCCCCCCCC---------------------160 (432)
Q d20180925_281VCVA----------------PVKS---L------VSRRHQRG--GVKFLWWPHTFRGIE---------------------160 (432)
T 3DMQ_B81GTRLDTEESGVALREVFLDSKLVFSKPQDRLFAGQIDRMDRFALRYRARKYSSEQFRMPYSGLRGQRTSLIPHQLNIAHD160 (432)
T ss_pred81ECCCCCCCCHHHHHHHHHHHHHHHCCCHHHHHHCCCCCHHHHHHHHHHHHCCCHHHCCCCCCCCCCCCCCCHHHHHHHHH160 (432)
T ss_dssp81EEETTTCCCSEEEEGGGBCSCCCCCCHHHHTTCSSCCCHHHHTTHHHHHHHHHHHHTCSSCSSSCCSSCCCHHHHHHHHH160 (432)
Q ss_pred161----CCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHCCCCCCEEEEECCCCCC240 (432)
Q d20180925_2161----NSKVCIMADEMGIQKTLMCITLIWPLLKQSADCGPEIDKKWVVPPSHLNGNQYNEVGKWLGGDVQGVAIDGIDKDN240 (432)
T 3DMQ_B161VGRRHAPRVLLADEVGLGKTIEAGMILHQQLLS-----GAAERVLIIVPETLQHQWLVEMLRRFN--LRFALFDD-----240 (432)
T ss_pred161HHHCCCCCEEEECCCCCCHHHHHHHHHHHHHHC-----CCCCCEEEEECCCCHHHHHHHHHHHCC--CCEEEEEC-----240 (432)
T ss_dssp161HHHSSSCEEEECCCTTSCHHHHHHHHHHHHHHT-----SSCCCEEEECCTTTHHHHHHHHHHSSC--CCCEECCH-----240 (432)
Q ss_pred241CHHHHHHCCCCCCCCCCCCEEEEEHHHHHHH---HHHHHCCCCCEEEECCCCCCCC---CCCHHHHHHHC--CCCCCEEE320 (432)
Q d20180925_2241EDSKCVNQIPMQGMRWPTPIYIINYETFRNH---AEVLCKGKQGLWICREGHSKKD---SDFHTYCALPT--MNNQRRVD320 (432)
T 3DMQ_B241ERYAEAQHDAY-NPFDTEQLVICSLDFARRSKQRLEHLCEAEWDLLVVDEAHHLVWSEDAPSREYQAIEQLAEHVPGVLL320 (432)
T ss_pred241CHHHHHHHHHC-CCCCCCCEEEECHHHHHCCHHHHHHHHCCCCCEEEECCHHCCCCCCCCCHHHHHHHHHHHHHCCCEEE320 (432)
T ss_dssp241HHHHHHHHTTC-SSSTTCSEEEECHHHHHTSTTTTHHHHTSCCCEEEECCSSCCCCBTTBCCHHHHHHHHHHTTCSSEEE320 (432)
Q ss_pred321EECCCCCCCHHHHHHHHHHHCCCCCCCHHHHHHHCC-------CCCCCCC------------------------------400 (432)
Q d20180925_2321ISGTPPQNDLLGYWSLVEHQQSSPLGTHQEWGHRFE-------IPNLKGR------------------------------400 (432)
T 3DMQ_B321LTATPEQLGMESHFARLRLLDPNRFHDFAQFVEEQKNYCPVADAVAMLLAGNKLSNDELNMLGEMIGEQDIEPLLQAANS400 (432)
T ss_pred321EEECCCCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH400 (432)
T ss_dssp321SCSSCSSSCSSCTHHHHHHHCTTTCSSTHHHHHHHHHHHHHHHHHHTTTTSCCCCGGGTTSSTTTTCTTCSSTTHHHHCC400 (432)
Q ss_pred401CCCCCHH-HHHHHHHHHHHHHHHH-HHHHHCC432 (432)
Q d20180925_2401DADAPDK-DRGAGTFKYQHCISIV-NWAYCHE432 (432)
T 3DMQ_B401DSEDAQSARQELVSMLMDRHGTSRVLFRNTRN432 (432)
T ss_pred401HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH432 (432)
T ss_dssp401CSSCSTTTHHHHHHHHGGGCTTTTTEECCCTT432 (432)


No 5
> 3LY5_A    ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens}     Alignment in PIR format
MAC score = 70.73	Identity = 0.1

Download partial structureDownload full-length structure
Q ss_pred1C---------------CCCCC-CC--CCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCC-------CCEEEECCCCCCC80 (304)
Q d20180925_21L---------------GLRRA-LP--PKFRKDKFEDDAPVLKEPPANCTHDLIKADKEAL-------RVHVCVAPVKSLV80 (304)
T 3LY5_A1MHHHHHHSSGVDLGTENLYFQSMNNVEKPDNDEDESEVPSLPLGLTGA----FEDTSFASLCNLVNENTLKAIKEMGFTN80 (304)
T ss_pred1CCCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCHHHHHHCCCHHHHHHHHHCCCCC80 (304)
T ss_dssp1UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUCCB----SGGGCCUUUUUCCCHHHHHHHHHTTCCB80 (304)
Q ss_pred81CCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCC-CCCCEEEECCCCCCHHHHHHHH160 (304)
Q d20180925_281SRRHQRGGVKFLWWPHTFRGIENSKVCIMADEMGIQKTLMCITLIWPLLKQSADCGP-EIDKKWVVPPSHLNGNQYNEVG160 (304)
T 3LY5_A81MTEIQHKSIRPLLEGRD---------LLAAAKTGSGKTLAFLIPAVELIVKLRFMPRNGTGVLILSPTRELAMQTFGVLK160 (304)
T ss_pred81CCHHHHHHHHHHHCCCC---------EEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCHHHHHHHHHHHH160 (304)
T ss_dssp81CCHHHHHHHHHHHHTCC---------CEECCCTTSCHHHHHHHHHHHHHHHTTCCGGGCCCEEEECSSHHHHHHHHHHHH160 (304)
Q ss_pred161HHCCC-CCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCCEEEEEHHHHHHHHHHHHC---CCCCEEEECCCCCCCC--CC240 (304)
Q d20180925_2161KWLGG-DVQGVAIDGIDKDNEDSKCVNQIPMQGMRWPTPIYIINYETFRNHAEVLCK---GKQGLWICREGHSKKD--SD240 (304)
T 3LY5_A161ELMTHHVHTYGLIMGGSNRSAEAQKLGN--------GINIIVATPGRLLDHMQNTPGFMYKNLQCLVIDEADRILDVGFE240 (304)
T ss_pred161HHHHHCCCEEEEEECCCCHHHHHHHHCC--------CCCEEEECHHHHHHHHHCCCCCCHHCCEEEEECCCCHHHHHCHH240 (304)
T ss_dssp161HHTTTCCSCEEEECSSSCHHHHHHHHHH--------CCSEEEECHHHHHHHHHHCTTCCCTTCCEEEECSHHHHHHTTCH240 (304)
Q ss_pred241CHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCCCCHHHHHHHCCCCCCCCCCCCC304 (304)
Q d20180925_2241FHTYCALPTMNNQRRVDISGTPPQNDLLGYWSLVEHQQSSPLGTHQEWGHRFEIPNLKGRDADA304 (304)
T 3LY5_A241EELKQIIKLLPTRRQTMLFSATQTRKVEDLARISLKK-EPLYV--------------------G304 (304)
T ss_pred241HHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHCCC-CCEEC--------------------C304 (304)
T ss_dssp241HHHHHHHHHSCSSSEEEEECSSCCHHHHHHHHHHCSS-CCEEC--------------------U304 (304)


No 6
> 2PL3_A    Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens}     Alignment in PIR format
MAC score = 68.39	Identity = 0.11

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCEEEEC--------CCCCCCCCHHHHHHHHHHHHCCC80 (292)
Q d20180925_21LGLRRALPPKFRKDKFEDDAPVLKEPPANCTHDLIKADKEALRVHVCVA--------PVKSLVSRRHQRGGVKFLWWPHT80 (292)
T 2PL3_A1SRLMQN-YEKIN------------------VNEI-TRFS-----DFPLSKKTLKGLQEAQYRLVTEIQKQTIGLALQ---80 (292)
T ss_pred1HHHHHC-CCCCC------------------CCCC-CCHH-----HCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHC---80 (292)
T ss_dssp1HHHHHT-TTTCC------------------GGGC-SBGG-----GSCCCHHHHHHHHHTTCCBCCHHHHHHHHHHHT---80 (292)
Q ss_pred81CCCCCCCCCCCCCCCCCCCHHHH-HHHHHHHHHHCCCCCCCCCCCEEEECC-CCCCHHHHHHHHHHCCC-CCCEEEEECC160 (292)
Q d20180925_281FRGIENSKVCIMADEMGIQKTLM-CITLIWPLLKQSADCGPEIDKKWVVPP-SHLNGNQYNEVGKWLGG-DVQGVAIDGI160 (292)
T 2PL3_A81-----G-KDVLGAAKTGSGKTLAFLVPVLEALYRLQW-TSTDGLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGLIIGG160 (292)
T ss_pred81-----C-CCEEEECCCCCHHHHHHHHHHHHHHHHHCC-CCCCCCEEEEECCCHHHHHHHHHHHHHHHCCCCCEEEEEECC160 (292)
T ss_dssp81-----T-CCEEEECCTTSCHHHHHHHHHHHHHHHTTC-CGGGCCCEEEECSSHHHHHHHHHHHHHHTTTSSCCEEEECCC160 (292)
Q ss_pred161CCCCCHHHHHHCCCCCCCCCCCCEEEEEHHHHHHHHHHHHC---CCCCEEEECCCCCCCC--CCCHHHHHHHCCCCCCEE240 (292)
Q d20180925_2161DKDNEDSKCVNQIPMQGMRWPTPIYIINYETFRNHAEVLCK---GKQGLWICREGHSKKD--SDFHTYCALPTMNNQRRV240 (292)
T 2PL3_A161KDLKHEAERI--------N-NINILVCTPGRLLQHMDETVSFHATDLQMLVLDEADRILDMGFADTMNAVIENLPKKRQT240 (292)
T ss_pred161CCHHHHHHHC--------C-CCCEEEECHHHHHHHHHHCCCCCHHHCCEEEEECHHHHHCCCCHHHHHHHHHHCCCCCEE240 (292)
T ss_dssp161UUCHHHHHHH--------T-TCSEEEECHHHHHHHHHHCSSCCCTTCCEEEETTHHHHHHTTTHHHHHHHHHTSCTTSEE240 (292)
Q ss_pred241EEECCCCCCCHHHHHHHHHHHCCCCCCCHHHHHHHCCCCCCCCCCCCCCHHH292 (292)
Q d20180925_2241DISGTPPQNDLLGYWSLVEHQQSSPLGTHQEWGHRFEIPNLKGRDADAPDKD292 (292)
T 2PL3_A241LLFSATQTKSVKD---LARLSLKN------------------PEYVWVHEKA292 (292)
T ss_pred241EEEECCCCHHHHH---HHHHHCCC------------------CEEEECCCCC292 (292)
T ss_dssp241EEEESSCCHHHHH---HHHHSCSS------------------CEEEECCCUU292 (292)


No 7
> 4A36_B        Alignment in PIR format
MAC score = 67.67	Identity = 0.12

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCEEEECCCCCCHH80 (274)
Q d20180925_21APVKSLVSRRHQRGGVKFLWWPHTFRGIENSKVCIMADEMGIQKTLMCITLIWPLLKQSADCGPEIDKKWVVPPSHLNGN80 (274)
T 4A36_B1GAMETKKARSYQIELAQPAIN--------G-KNALICAPTGSGKTFVSILICEHHFQNMPA-GRKAKVVFLATKVPVYEQ80 (274)
T ss_pred1CCCCCCCCCHHHHHHHHHHHC--------C-CCEEEECCCCCCHHHHHHHHHHHHHHHCCC-CCCCEEEEECCCHHHHHH80 (274)
T ss_dssp1UUUUCCCCCHHHHHHHHHHHT--------T-CCEEEECCTTSCHHHHHHHHHHHHHTTCCS-SCCCCEEEECSSHHHHHH80 (274)
Q ss_pred81HHHHHHHHCCCC-CCEEEEECCCCCCCHHHHHHCCCCCCCCCCCCEEEEEHHHHHHHHHHHHC---CCCCEEEECCCCCC160 (274)
Q d20180925_281QYNEVGKWLGGD-VQGVAIDGIDKDNEDSKCVNQIPMQGMRWPTPIYIINYETFRNHAEVLCK---GKQGLWICREGHSK160 (274)
T 4A36_B81QKNVFKHHFERQGYSVQGISGENFSNV---SVEKVI-----EDSDIIVVTPQILVNSFEDGTLTSLSIFTLMIFDECHNT160 (274)
T ss_pred81HHHHHHHHHCCCCEEEEEEECCCCCCH---HHHHHH-----HCCCEEEECHHHHHHHHHCCCCCCCCCCEEEEEECHHHC160 (274)
T ss_dssp81HHHHHHHHHTTTTCCEEEECTTTGGGS---CHHHHH-----HHCSEEEECHHHHHHHHHTSSCCCGGGCSEEEETTGGGC160 (274)
Q ss_pred161CCCC--CHH----HHHHHC--CCCCCEEEEECCCCCC---C----HHHHHHHHHHHCC---CCC-CCHHHHHHHCCCC-C240 (274)
Q d20180925_2161KDSD--FHT----YCALPT--MNNQRRVDISGTPPQN---D----LLGYWSLVEHQQS---SPL-GTHQEWGHRFEIP-N240 (274)
T 4A36_B161TGNHPYNVLMTRYLEQKFNSASQLPQILGLTASVGVGNAKNIEETIEHICSLCSYLDIQAISTVRENIQELQRFMNKPEI240 (274)
T ss_pred161CCCCHHHHHHHHHHHHHHHHCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHCCCCCCCHHHHHHCCCCCE240 (274)
T ss_dssp161CTTSHHHHHHHHHHHHHHHTCSCCCEEEEEESCCCCTTCSSHHHHHHHHHHHHHHTTCSEEECCCTTHHHHHHHCCCCCC240 (274)
Q ss_pred241CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCC274 (274)
Q d20180925_2241LKGRDADAPDKDRGAGTFKYQHCISIVNWAYCHE274 (274)
T 4A36_B241DVRLVKRRIH---NPFAAIISNLMSETEALMRTI274 (274)
T ss_pred241EEEEEECCCH---HHHHHHHHHHHHHHHHHHHHH274 (274)
T ss_dssp241BCCBCCCCSC---CHHHHHHHHHHHHHHHHHHTT274 (274)


No 8
> 3FHC_B        Alignment in PIR format
MAC score = 66.06	Identity = 0.08

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCEEEECCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCC80 (276)
Q d20180925_21GLRRALPPKFRKDKFEDDAPVLKEPPANCTHDLIKADKEALRVHVCVAPVKSLVSRRHQRGGVKFLWWPHTFRGIENSKV80 (276)
T 3FHC_B1SNLVDNTNQVEVLQRDPNSP---LYSVKSFEELRL-KPQLL--Q-GVYAMGFNRPSKIQENALPLMLA-------EPPQN80 (276)
T ss_pred1CCCCCCHHHCCCCCCCCCCC---CCCCCCHHHCCC-CHHHH--H-HHHHCCCCCCCHHHHHHHHHHHC-------CCCCC80 (276)
T ss_dssp1UUUUUUUCCEEEEECCTTSC---CCCCSCGGGGTC-CHHHH--H-HHHHTTCCSCCHHHHHHHHHHHS-------SSCCC80 (276)
Q ss_pred81CCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHCCC--CCCEEEEECCCCCCCHHHHH160 (276)
Q d20180925_281CIMADEMGIQKTLMCITLIWPLLKQSADCGPEIDKKWVVPPSHLNGNQYNEVGKWLGG--DVQGVAIDGIDKDNEDSKCV160 (276)
T 3FHC_B81LIAQS--QSGTGKTAAFVLA-MLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERG----160 (276)
T ss_pred81EEEEE--CCCCCHHHHHHHH-HHHHHCCCCCCCEEEEECCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHH----160 (276)
T ss_dssp81EEEEC--CCSHHHHHHHHHH-HHHHCCTTSCSCCEEEECSSHHHHHHHHHHHHHHTTTCSSCCEEEESTTCCCCSS----160 (276)
Q ss_pred161HCCCCCCCCCCCCEEEEEHHHHHHHHHHHHC---CCCCEEEECCCCCCC---CCCCHHHHHHHCCCCCCEEEEECCCCCC240 (276)
Q d20180925_2161NQIPMQGMRWPTPIYIINYETFRNHAEVLCK---GKQGLWICREGHSKK---DSDFHTYCALPTMNNQRRVDISGTPPQN240 (276)
T 3FHC_B161-------QKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFED240 (276)
T ss_pred161-------HHHCCCEEECCCHHHHHHHHCCCCCCHHCEEEEEECHHHHHHHHCCCHHHHHHHHHHCCCHHEEEEEECCCCH240 (276)
T ss_dssp161-------CCCCCSEEEECHHHHHHHHHHSCCCCGGGCCEEEECCHHHHTTSTTHHHHHHHHHHHSCTTSEEEEEESCCCH240 (276)
Q ss_pred241CHHHHHHHHHHHCCCCCCCHHHHHHHCCCCCCCCCC276 (276)
Q d20180925_2241DLLGYWSLVEHQQSSPLGTHQEWGHRFEIPNLKGRD276 (276)
T 3FHC_B241SVWKFAQKV--VPDPNVIKLKREE-----------E276 (276)
T ss_pred241HHHHHHHHH--CCCCEEEEEECCC-----------C276 (276)
T ss_dssp241HHHHHHHHH--SSSCEEEEECUUU-----------U276 (276)


No 9
> 3II0_A        Alignment in PIR format
MAC score = 65.81	Identity = 0.08

Download partial structureDownload full-length structure
Q ss_pred1CCC-C-CCCCCCCCCCCCCCCCC----CCC-----CCCCCCCHHHHHHCCCCCCC-EEEECCCCCCCCCHHHHHHHHHHH80 (344)
Q d20180925_21LGL-R-RALPPKFRKDKFEDDAP----VLK-----EPPANCTHDLIKADKEALRV-HVCVAPVKSLVSRRHQRGGVKFLW80 (344)
T 3II0_A1MQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWVLPVVKKVEQKIANDNSLNHEYLPI---LGLAEFRSCASRLAL80 (344)
T ss_pred1CCCCHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCC---CCCHHHHHHHHHHHH80 (344)
T ss_dssp1UUCCHHHHHHHHHHHCCCTTCEECSSCCCCCTTSCCCCCHHHHHHHHHHHTCTTCCCCCCCT---TCCHHHHHHHHHHHH80 (344)
Q ss_pred81HCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHCCCCCCEEEEEC160 (344)
Q d20180925_281WPHTFRGIENSKVCIMADEMGIQKTLMCITLIWPLLKQSADCGPEIDKKWVVPPSHLNGNQYNEVGKWLGGDVQGVAIDG160 (344)
T 3II0_A81GDDS-PALKEKRVGGV---QSLGGTGALRIGADFLARWYNGTN--NKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWD160 (344)
T ss_pred81HHCC-CCCCCCCEEEE---EECCCHHHHHHHHHHHHHHHHHHC--CCCCEEEECCCCCCCHHHHHHHCCCEEEEEECCCC160 (344)
T ss_dssp81CTTC-HHHHTTCEEEE---EEEHHHHHHHHHHHHHHHHSSSSS--CCCSCEEEEESCCTHHHHHHHHTTCCCEEEEECEE160 (344)
Q ss_pred161CCCCCCHHHHHHCCCCCCCCCCCC-----------EEEEEHHHHHHHHHHHHCCCCCEEEECCCCCCC-C---CCCHHHH240 (344)
Q d20180925_2161IDKDNEDSKCVNQIPMQGMRWPTP-----------IYIINYETFRNHAEVLCKGKQGLWICREGHSKK-D---SDFHTYC240 (344)
T 3II0_A161AEKRGLDLQGFLNDLEN-APEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWAIR240 (344)
T ss_pred161CCCCCCCHHHHHHHHHH-CCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHH240 (344)
T ss_dssp161TTTTEECHHHHHHHHHT-SCTTCEEEEECSSCTTTCCCCCHHHHHHHHHHHHHHTCEEEEEESCTTTTTSCHHHHTHHHH240 (344)
Q ss_pred241HHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCCCCHHHHHHHCCCCCCCCC----------------CCCCCHHHH320 (344)
Q d20180925_2241ALPTMNNQRRVDISGTPPQNDLLGYWSLVEHQQSSPLGTHQEWGHRFEIPNLKGR----------------DADAPDKDR320 (344)
T 3II0_A241YFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEP-ESILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWT320 (344)
T ss_pred241HHHHCCCCEEEEECCHHHHHHHHHHEEEEEEECCCH-HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCHHHHHHHH320 (344)
T ss_dssp241HHHHTTCCEEEEEECTTTTCCGGGCEEEEEEECSSH-HHHHHHHHHHHHHHHTTTSSCCSHHHHHHHHHHTSHHHHHHHH320 (344)
Q ss_pred321HHHHHHHHHHHHH---HHHHHHCC344 (344)
Q d20180925_2321GAGTFKYQHCISI---VNWAYCHE344 (344)
T 3II0_A321GNVKTMADRILTMRSELRARLEAL344 (344)
T ss_pred321HHHHHHHHHHHHHHHHHHHHHHHC344 (344)
T ss_dssp321HHHHHHHHHHHHHHHHHHHHHHHT344 (344)


No 10
> 2GXS_A        Alignment in PIR format
MAC score = 65.23	Identity = 0.13

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCHHHHHHCCCCCCCEEEECCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHH80 (259)
Q d20180925_21DDAPVLKEPPANCTHDLIKADKEALRVHVCVAPVKSLVSRRHQRGGVKFLWWPHTFRGIENSKVCIMADEMGIQKTLMCI80 (259)
T 2GXS_A1ME---FKD--FPLKPEILEALHGR----------GLTTPTPIQAAALPLALE---------GKDLIGQARTGTGKTLAFA80 (259)
T ss_pred1CC---HHH--CCCCHHHHHHHHHC----------CCCCCCHHHHHHHHHHHC---------CCCEEEECCCCCCHHHHHH80 (259)
T ss_dssp1CC---GGG--SSCCHHHHHHHHHT----------TCCSCCHHHHHHHHHHTT---------TCCEEEECCTTSCHHHHHH80 (259)
Q ss_pred81HHHHHHHHCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCCEEEEE160 (259)
Q d20180925_281TLIWPLLKQSADCGPEIDKKWVVPPSHLNGNQYNEVGKWLGGDVQGVAIDGIDKDNEDSKCVNQIPMQGMRWPTPIYIIN160 (259)
T 2GXS_A81LPIAERLAPSQERGRKPRALVLTPTRELALQVASELTAVAP-HLKVVAVYGGTGYGKQKEALLR--------GADAVVAT160 (259)
T ss_pred81HHHHHHHCCCCCCCCCCEEEEECCCHHHHHHHHHHHHHHHC-CCCEEEEECCCCHHHHHHHHHC--------CCCEEECC160 (259)
T ss_dssp81HHHHHHCCCCCCTTCCCSEEEECSSHHHHHHHHHHHHHHCT-TSCEEEECSSSCSHHHHHHHHH--------CCSEEEEC160 (259)
Q ss_pred161HHHHHHHHHHH--HCCCCCEEEECCCCCCCCC--CCHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCCCCH240 (259)
Q d20180925_2161YETFRNHAEVL--CKGKQGLWICREGHSKKDS--DFHTYCALPTMNNQRRVDISGTPPQNDLLGYWSLVEHQQSSPLGTH240 (259)
T 2GXS_A161PGRALDYLRQGVLDLSRVEVAVLDEADEMLSMGFEEEVEALLSATPPSRQTLLFSATLPSWAKR---LAERYMKNP----240 (259)
T ss_pred161CHHHHHHHHCCCEEECCCCEEEEEHHHHHHCCCCHHHHHHHHHHCCHHHHHEEEECCCCHHHHH---HHHHHHCCC----240 (259)
T ss_dssp161HHHHHHHHHHTSSCCTTCSEEEECSHHHHHHTTCHHHHHHHHHTSCTTSEEEEECSSCCHHHHH---HHHHHCSSC----240 (259)
Q ss_pred241HHHHHHCCCCCCCCCCCCC259 (259)
Q d20180925_2241QEWGHRFEIPNLKGRDADA259 (259)
T 2GXS_A241-------VLINV---I--K259 (259)
T ss_pred241-------EEEEE---E--C259 (259)
T ss_dssp241-------EEEEC---C--U259 (259)