TreeThreader - Results

  Job information

Job ID: d20180925
#Proteins: 4
Protein ID: d20180925_1
Fasta ID: seq1
Submission time: 2018-09-25 10:54:02 +0800
Finished time: 2019-02-17 19:19:55 +0800
Identical Job(s): NULL

  Alignments

1
50
100
150
200
250
298
1Z3I_X 1Z3I_X 1Z6A_A 1Z6A_A 3MWY_W 3MWY_W 3DMQ_B 3DMQ_B 3II0_A 3II0_A 1G4V_A 1G4V_A 1AJS_A 1AJS_A 4A36_B 4A36_B 1ARH_A 1ARH_A 2D7Z_A 2D7Z_A

  Build multi-template model (choose up to 5 templates)

                   
Download full-length structure

  Top 10 hits

Query:
Job ID  : d20180925_1
Length : 298
Sequence: LGLRVASVRWMLHKPIKDGPLVLYPGCAIWGHDLIKEDKYRDPEPYVVDPVLSCVNGVIQRGGEKFTWDCVTTRRCEISY GIIMADEEHLGKGLQCITPSYTLVMQDPDIKSVIDKVIVVSPASLQRNWMNESGKWYGGRVQDVAIDGHSKDESDSKLVR FRSQQGMEIPTRILRISYSTFRLHAEVLLKGKVCPVICDEGHRHTNSDNQTNLALNSFNAQRRVLISGTPILNWLLEYFS GVHIVNSIILGTAQEEKKRFEIPILKMRDAYASDADRALYGQKGRPMISIVNRCPIWR

No Hit MAC Score Identity Cols Query HMM Template HMM
11Z3I_X220.440.722981-2981-298
21Z6A_A126.660.192451-2981-264
33MWY_W116.820.182811-298140-478
43DMQ_B91.420.142831-2985-422
53II0_A75.070.082861-2982-326
61G4V_A73.970.112761-2989-325
71AJS_A73.950.082781-2983-337
84A36_B73.50.123136-2981-260
91ARH_A73.310.12741-2989-325
102D7Z_A73.180.12751-2983-325

  Pairwise Query-Template Alignment

No 1
> 1Z3I_X    Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19     Alignment in PIR format
MAC score = 220.44	Identity = 0.72

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEHHHCCCCCCCCCCC80 (298)
Q d20180925_11LGLRVASVRWMLHKPIKDGPLVLYPGCAIWGHDLIKEDKYRDPEPYVVDPVLSCVNGVIQRGGEKFTWDCVTTRRCEISY80 (298)
T 1Z3I_X1LGLRRAGVRKALHDPFEDGALVLYEPPAISAHDLIKADKEKLPVHVVVDPVLSKVLRPHQREGVKFLWDCVTGRRIENSY80 (298)
T ss_pred1CCCCCCCCCCCCCCCCCCCCEECCCCCCCCHHHHHCCCCCCCCCCEEECHHHCCCCHHHHHHHHHHHHHHHHCCCCCCCC80 (298)
T ss_dssp1CCSSCSSSCCCSSCTTSTTCCEEECCCCCCHHHHHHSCGGGSCCCEECCHHHHTTCCHHHHHHHHHHHHHHTTSSSTTCC80 (298)
Q ss_pred81CCEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHH160 (298)
Q d20180925_181GIIMADEEHLGKGLQCITPSYTLVMQDPDIKSVIDKVIVVSPASLQRNWMNESGKWYGGRVQDVAIDGHSKDESDSKLVR160 (298)
T 1Z3I_X81GCIMADEMGLGKTLQCITLIWTLLKQSPDCKPEIDKVIVVSPSSLVRNWYNEVGKWLGGRVQPVAIDGGSKDEIDSKLVN160 (298)
T ss_pred81CEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCEEEECCHHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHH160 (298)
T ss_dssp81EEEECCCTTSCHHHHHHHHHHHHHHCCTTSSCSCSCEEEEECHHHHHHHHHHHHHHHGGGCCEEEECSSCHHHHHHHHHH160 (298)
Q ss_pred161HHHHCCCCCCCEEEEEEHHHHHHHHHHHHCCCCCCEECCCCHHCCCCCCHHHHHHHCCCCCCEEEEECCCCCCCHHHHHH240 (298)
Q d20180925_1161FRSQQGMEIPTRILRISYSTFRLHAEVLLKGKVCPVICDEGHRHTNSDNQTNLALNSFNAQRRVLISGTPILNWLLEYFS240 (298)
T 1Z3I_X161FISQQGMRIPTPILIISYETFRLHAEVLHKGKVGLVICDEGHRLKNSDNQTYLALNSMNAQRRVLISGTPIQNDLLEYFS240 (298)
T ss_pred161HHHHCCCCCCCCEEEECHHHHHHHHHHHHCCCCCEEEEECCHHHCCCHHHHHHHHHHHHHCEEEEECCCCCCCCHHHHHH240 (298)
T ss_dssp161HHCCCSSCCSCCEEEEEHHHHHHHTTTTTTSCCCEEEETTGGGCCTTCHHHHHHHHHHCCSEEEEECSSCSGGGGGGCHH240 (298)
Q ss_pred241HHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCC298 (298)
Q d20180925_1241GVHIVNSIILGTAQEEKKRFEIPILKMRDAYASDADRALYGQKGRPMISIVNRCPIWR298 (298)
T 1Z3I_X241LVHFVNSGILGTAQEFKKRFEIPILKGRDADASDKDRAAGEQKLQELISIVNRCLIRR298 (298)
T ss_pred241HHHHHCCCCCCCHHHHHHHHCCHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHC298 (298)
T ss_dssp241HHHHHHHHHHCCHHHHHHHTHHHHHHHHSTTCCSHHHHHHHHHHHHHHHHHHHHEECC298 (298)


No 2
> 1Z6A_A        Alignment in PIR format
MAC score = 126.66	Identity = 0.19

Download partial structureDownload full-length structure
Q ss_pred1C--CCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEHHHCCCCCCCCC80 (317)
Q d20180925_11L--GLRVASVRWMLHKPIKDGPLVLYPGCAIWGHDLIKEDKYRDPEPYVVDPVLSCVNGVIQRGGEKFTWDCVTTRRCEI80 (317)
T 1Z6A_A1MGSSHHHHH-----H-SSGLVPRGSHMAS----------KSFQL---LE-PYNIKANLRPYQIKGFSWM-----RFMNKL80 (317)
T ss_pred1CCHHHHHHH-----H-HHHHHHHHCCCCC----------CCCCC---CC-CCCCCCEECHHHHHHHHHH-----HHHHHC80 (317)
T ss_dssp1UUUUUUUUU-----U-UUUCCCCBCCSCT----------TSSCC---CC-CCSCSSCCCHHHHHHHHHH-----HHHHHT80 (317)
Q ss_pred81CCCCEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHH160 (317)
Q d20180925_181SYGIIMADEEHLGKGLQCITPSYTLVMQDPDIKSVIDKVIVVSPASLQRNWMNESGKWYGGRVQDVAIDGHSKDESDSKL160 (317)
T 1Z6A_A81GFGICLADDMGLGKTLQTIAVFSDAK-KE----NELTPSLVICPLSVLKNWEEELSKFAPHL-RFAVFHED-RSKI--KL160 (317)
T ss_pred81CCCEEECCCCCCCCHHHHHHHHHHHH-HC----CCCCCEEEEEECCHHHHHHHHHHHHCCCC-EEEEEECC-HHHH--HH160 (317)
T ss_dssp81TCCEEECCCTTSCHHHHHHHHHHHTT-TT----TCCSSEEEECCHHHHHHHHHHHHHHCTTS-CEEECCSS-CCSC--CG160 (317)
Q ss_pred161HHHHHHCCCCCCCEEEEEEHHHHHHHHHHHHCCCCCCEECCCCHHCCCCCCHHHHHHHCCCCCCEEEEECCCCCCCHHHH240 (317)
Q d20180925_1161VRFRSQQGMEIPTRILRISYSTFRLHAEVLLKGKVCPVICDEGHRHTNSDNQTNLALNSFNAQRRVLISGTPILNWLLEY240 (317)
T 1Z6A_A161---E-------DYDIILTTYAVLLRD-TRLKEVEWKYIVIDEAQNIKNPQTKIFKAVKELKSKYRIALTGTPIENKVDDL240 (317)
T ss_pred161---C-------CCCEEEECHHHHHHH-HHHCCCCCCEEEEECHHHCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHH240 (317)
T ss_dssp161---G-------GSSEEEECSHHHHSC-CTTTTSCCSEEEEECCSCCSCCCSHHHHHHTTSCCSEEEEECSCCCTTTHHHH240 (317)
Q ss_pred241HHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCC-----------------CC317 (317)
Q d20180925_1241FSGVHIVNSIILGTAQEEKKRFEIPILKMRDAYASDADRALYGQKGRPMISIVNRCPI-----------------WR317 (317)
T 1Z6A_A241WSIMTFLNPGLLGSYSEFKSKFATPIKK----G-DNMAKE---ELKAIISPFILRRTKYDKAIINDLPDKIETNVYC317 (317)
T ss_pred241HHHHHHHCCCCCCCHHHHHHHHHHHHCC----C-CHHHHH---HHHHHHHHHHHHHHCCHHHHHHCCCCCEEEEEEE317 (317)
T ss_dssp241HHHHHHHSTTTTCCHHHHHHHTHHHHHT----T-CHHHHH---HHHHHHGGGEEBCCTTCHHHHHHSCSEEEEEEEE317 (317)


No 3
> 3MWY_W    Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: AGS; 3.70A {Saccharomyces cerevisiae}     Alignment in PIR format
MAC score = 116.82	Identity = 0.18

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCC-CCCCCC-C-------CCCCCCEEECCCCCCCCCCCCCCCCC--CCCCCC-----------------------80 (356)
Q d20180925_11LGLRVAS-VRWMLH-K-------PIKDGPLVLYPGCAIWGHDLIKEDKY--RDPEPY-----------------------80 (356)
T 3MWY_W1DEFEEFHVPERIIDSQRASLEDGTSQLQYLVKWRRLNYDEATWENATDIVKLAPEQVKHFQNRENSKILPQYSSNYTSQR80 (356)
T ss_pred1HHHHHHHHHHHEEEECCCCCCCCCCCEEEEEEECCCCCCCEEECCHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHCCCCC80 (356)
T ss_dssp1HHHTTTTCEEEECCCCCEECTTSCEECBCCEEETTSCSTTCBCCBHHHHTTTCHHHHHHHHHTTTCTTCSTTCCCCCSCC80 (356)
Q ss_pred81-------CCCCCCC-CCCCCCCCCCEEEHHHCCCCCCCCCCCCCEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCE160 (356)
Q d20180925_181-------VVDPVLS-CVNGVIQRGGEKFTWDCVTTRRCEISYGIIMADEEHLGKGLQCITPSYTLVMQDPDIKSVIDKVI160 (356)
T 3MWY_W81PRFEKLSVQPPFIKGGELRDFQLTGINWMA-----FLWSKGDNGILADEMGLGKTVQTVAFISWLIFAR----RQNGPHI160 (356)
T ss_pred81CCCCCCCCCCCCCCCCCCCHHHHHHHHHHH-----HHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC----CCCCCEE160 (356)
T ss_dssp81CCCCCCSSCCTTCCSSCCCTHHHHHHHHHH-----HHHTTTCCEEECCCTTSSTTHHHHHHHHHHHHHH----SCCSCEE160 (356)
Q ss_pred161EEECCCCHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHCCC------CCCCEEEEEEHHHHHHHHHHHHCCC240 (356)
Q d20180925_1161VVSPASLQRNWMNESGKWYGGRVQDVAIDGHSKDESDSKLVRFRSQQGM------EIPTRILRISYSTFRLHAEVLLKGK240 (356)
T 3MWY_W161IVVPLSTMPAWLDTFEKWAPDLNCICYMG---NQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSIK240 (356)
T ss_pred161EEECHHHHHHHHHHHHHHCCCCEEEEEEC---CHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEECHHHHHHHHHHHHCCC240 (356)
T ss_dssp161EECCTTTHHHHHHHHHHHSTTCCEEECCC---SSHHHHHHHHHHSCSCCUUUUUCCCCCSEEEECTTHHHHTHHHHHTSE240 (356)
Q ss_pred241CCCEECCCCHHCCCCCCHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCC---------CCCHHHHHHHHHHH320 (356)
Q d20180925_1241VCPVICDEGHRHTNSDNQTNLALNSFNAQRRVLISGTPILNWLLEYFSGVHIVNSII---------LGTAQEEKKRFEIP320 (356)
T 3MWY_W241WQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEEYIHDL320 (356)
T ss_pred241CCEEEEECCCCCCCHHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHHHHCCCCCCCHHHHCCCCCCHHHHHHHHHH320 (356)
T ss_dssp241EEEEEETTGGGGCCSSSHHHHHHTTSEEEEEEEECSCCCSSCSHHHHHHHHHHCSCCCUUUUUUUUUCCTTHHHHHHHHH320 (356)
Q ss_pred321HHCCCCCCCCHHHHHHHHHHHH-HHHHHHHCCCCCC356 (356)
Q d20180925_1321ILKMRDAYASDADRALYGQKGR-PMISIVNRCPIWR356 (356)
T 3MWY_W321HRRIQPFILR-----RLKKDVEKSLPSKTERILRVE356 (356)
T ss_pred321HHHHHHHHHH-----HHHHHHHHHCCCCEEEEEEEC356 (356)
T ss_dssp321HHTTGGGEEE-----CCGGGGTTTSCCEEEEEEEEC356 (356)


No 4
> 3DMQ_B        Alignment in PIR format
MAC score = 91.42	Identity = 0.14

Download partial structureDownload full-length structure
Q ss_pred1CC---CCCCC--C-------C-----CCCC--------CCCCCCCEEECCCCCC---CCCC---CC-CCCCCC-------80 (433)
Q d20180925_11LG---LRVAS--V-------R-----WMLH--------KPIKDGPLVLYPGCAI---WGHD---LI-KEDKYR-------80 (433)
T 3DMQ_B1LGQRWISDTESELGLGTVVAVDARTVTLLFPSTGENRLYARSDSPVTRVMFNPGDTITSHDGWQMQVEEVKEENGLLTYI80 (433)
T ss_pred1CCCCCCCCCCCCCCCCEEEEECCEEEEEECCCCCHHHHHHHCCCCCEEEECCCCCEEECCCCCEEEEEECCCCCCEEEEE80 (433)
T ss_dssp1TTCEEEESSCGGGCEEEEEEECSSEEEEEETTTTEEEEEETTTCCEEECCCCTTCEEEBTTSCEEEEEEEEESSSCEEEE80 (433)
Q ss_pred81------CCC----CC-CCCC-----CCC------------------CC------CCCCCCCC--------EEEHHHCCC-160 (433)
Q d20180925_181------DPE----PY-VVDP-----VLS------------------CV------NGVIQRGG--------EKFTWDCVT-160 (433)
T 3DMQ_B81GTRLDTEESGVALREVFLDSKLVFSKPQDRLFAGQIDRMDRFALRYRARKYSSEQFRMPYSGLRGQRTSLIPHQLNIAHD160 (433)
T ss_pred81ECCCCCCCCHHHHHHHHHHHHHHHCCCHHHHHHCCCCCHHHHHHHHHHHHCCCHHHCCCCCCCCCCCCCCCHHHHHHHHH160 (433)
T ss_dssp81EEETTTCCCSEEEEGGGBCSCCCCCCHHHHTTCSSCCCHHHHTTHHHHHHHHHHHHTCSSCSSSCCSSCCCHHHHHHHHH160 (433)
Q ss_pred161CCCCCCCCCCEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCHHHHHHHHHHHHCCCCCEEEEECCCCC240 (433)
Q d20180925_1161TRRCEISYGIIMADEEHLGKGLQCITPSYTLVMQDPDIKSVIDKVIVVSPASLQRNWMNESGKWYGGRVQDVAIDGHSKD240 (433)
T 3DMQ_B161VGRR-HAPRVLLADEVGLGKTIEAGMILHQQLLS-----GAAERVLIIVPETLQHQWLVEMLRRFN--LRFALFDDE---240 (433)
T ss_pred161HHHC-CCCCEEEECCCCCCHHHHHHHHHHHHHHC-----CCCCCEEEEECCCCHHHHHHHHHHHCC--CCEEEEECC---240 (433)
T ss_dssp161HHHS-SSCEEEECCCTTSCHHHHHHHHHHHHHHT-----SSCCCEEEECCTTTHHHHHHHHHHSSC--CCCEECCHH---240 (433)
Q ss_pred241HHHHHHHHHHHHCCCCCCCEEEEEEHHHHHHH---HHHHHCCCCCCEECCCCHHCCC---CCCHHHHHHHCC--CCCCEE320 (433)
Q d20180925_1241ESDSKLVRFRSQQGMEIPTRILRISYSTFRLH---AEVLLKGKVCPVICDEGHRHTN---SDNQTNLALNSF--NAQRRV320 (433)
T 3DMQ_B241-RYAEAQH-DAYNPF-DTEQLVICSLDFARRSKQRLEHLCEAEWDLLVVDEAHHLVWSEDAPSREYQAIEQLAEHVPGVL320 (433)
T ss_pred241-HHHHHHH-HHCCCC-CCCCEEEECHHHHHCCHHHHHHHHCCCCCEEEECCHHCCCCCCCCCHHHHHHHHHHHHHCCCEE320 (433)
T ss_dssp241-HHHHHHH-TTCSSS-TTCSEEEECHHHHHTSTTTTHHHHTSCCCEEEECCSSCCCCBTTBCCHHHHHHHHHHTTCSSEE320 (433)
Q ss_pred321EEECCCCCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHH-------HHHCCCCCC-------------------C------400 (433)
Q d20180925_1321LISGTPILNWLLEYFSGVHIVNSIILGTAQEEKKRFEI-------PILKMRDAY-------------------A------400 (433)
T 3DMQ_B321LLTATPEQLGMESHFARLRLLDPNRFHDFAQFVEEQKNYCPVADAVAMLLAGNKLSNDELNMLGEMIGEQDIEPLLQAAN400 (433)
T ss_pred321EEEECCCCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH400 (433)
T ss_dssp321ESCSSCSSSCSSCTHHHHHHHCTTTCSSTHHHHHHHHHHHHHHHHHHTTTTSCCCCGGGTTSSTTTTCTTCSSTTHHHHC400 (433)
Q ss_pred401C------HHHHHHHHHHHHHHHHHHHCCCCC-C433 (433)
Q d20180925_1401S------DADRALYGQKGRPMISIVNRCPIW-R433 (433)
T 3DMQ_B401SDSEDAQSARQELVSMLMD-RHGTSRVLFRNTR433 (433)
T ss_pred401HHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHH433 (433)
T ss_dssp401CCSSCSTTTHHHHHHHHGG-GCTTTTTEECCCT433 (433)


No 5
> 3II0_A        Alignment in PIR format
MAC score = 75.07	Identity = 0.08

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCCCCCEEECCCCCCC------CCCCCC----CC-CCC-CCCCCCCCCCCCCCCCCCCCCCEEEHH80 (337)
Q d20180925_11LGLRVASVRWMLHKPIKDGPLVLYPGCAIW------GHDLIK----ED-KYR-DPEPYVVDPVLSCVNGVIQRGGEKFTW80 (337)
T 3II0_A1QPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWVLPVVKKVEQKIANDNSLNHE-YLPILGL-------AEFRSCAS80 (337)
T ss_pred1CCCHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCC-CCCCCCC-------HHHHHHHH80 (337)
T ss_dssp1UCCHHHHHHHHHHHCCCTTCEECSSCCCCCTTSCCCCCHHHHHHHHHHHTCTTCCCC-CCCTTCC-------HHHHHHHH80 (337)
Q ss_pred81HCCCCCCCC-CCCCCEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCHHHHHHHHHHHHCCCCCEEEEE160 (337)
Q d20180925_181DCVTTRRCE-ISYGIIMADEEHLGKGLQCITPSYTLVMQDPDIKSVIDKVIVVSPASLQRNWMNESGKWYGGRVQDVAID160 (337)
T 3II0_A81RLALGDDSPALKEKRVGGV-QSLGGTGALRIGADFLARWYNGTN--NKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYW160 (337)
T ss_pred81HHHHHHCCCCCCCCCEEEE-EECCCHHHHHHHHHHHHHHHHHHC--CCCCEEEECCCCCCCHHHHHHHCCCEEEEEECCC160 (337)
T ss_dssp81HHHHCTTCHHHHTTCEEEE-EEEHHHHHHHHHHHHHHHHSSSSS--CCCSCEEEEESCCTHHHHHHHHTTCCCEEEEECE160 (337)
Q ss_pred161CCCCCHHHHHHHHHHHHCCCCCCC----------EEEEEEHHHHHHHHHHHHCCCCCCEECCCCHHCCC----CCCHHHH240 (337)
Q d20180925_1161GHSKDESDSKLVRFRSQQGMEIPT----------RILRISYSTFRLHAEVLLKGKVCPVICDEGHRHTN----SDNQTNL240 (337)
T 3II0_A161DAEKRGLDLQGFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWAIR240 (337)
T ss_pred161CCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHH240 (337)
T ss_dssp161ETTTTEECHHHHHHHHHTSCTTCEEEEECSSCTTTCCCCCHHHHHHHHHHHHHHTCEEEEEESCTTTTTSCHHHHTHHHH240 (337)
Q ss_pred241HHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCC------------CCHHHHHHHH320 (337)
Q d20180925_1241ALNSFNAQRRVLISGTPILNWLLEYFSGVHIVNSIILGTAQEEKKRFEIPILKMRDAY------------ASDADRALYG320 (337)
T 3II0_A241YFVSEGFEFFCAQSFSKNFGLYNERVGNL-TVVGKEPESILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWT320 (337)
T ss_pred241HHHHCCCCEEEEECCHHHHHHHHHHEEEE-EEECCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCHHHHHHHH320 (337)
T ss_dssp241HHHHTTCCEEEEEECTTTTCCGGGCEEEE-EEECSSHHHHHHHHHHHHHHHHTTTSSCCSHHHHHHHHHHTSHHHHHHHH320 (337)
Q ss_pred321HHHHHHHHHHHCCCCCC337 (337)
Q d20180925_1321QKGRPMISIVNRCPIWR337 (337)
T 3II0_A321GNVKTMADRILTMRSEL337 (337)
T ss_pred321HHHHHHHHHHHHHHHHH337 (337)
T ss_dssp321HHHHHHHHHHHHHHHHH337 (337)


No 6
> 1G4V_A        Alignment in PIR format
MAC score = 73.97	Identity = 0.11

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCC------CC----C--CCCCCCCCCCCCCCCCCCCCCCCCCCCEEEHH80 (339)
Q d20180925_11LGLRVASVRWMLHKPIKDGPLVLYPGCAIWGHD------LI----K--EDKYRDPEPYVVDPVLSCVNGVIQRGGEKFTW80 (339)
T 1G4V_A1PADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYL--GID-------GIPEFGRCTQ80 (339)
T ss_pred1CCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCC--CCC-------CCHHHHHHHH80 (339)
T ss_dssp1CCCTTHHHHHHHTTCCCTTCEECCCCSCCCTTSCCCCCHHHHHHHHHHHHHCCCCCCC--CTT-------CCHHHHHHHH80 (339)
Q ss_pred81HCCCCCCCCCC-CCCEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCHHHHHHHHHHHHCCCCCEEEEE160 (339)
Q d20180925_181DCVTTRRCEIS-YGIIMADEEHLGKGLQCITPSYTLVMQDPDIKSVIDKVIVVSPASLQRNWMNESGKWYGGRVQDVAID160 (339)
T 1G4V_A81ELLFGKGSALINDKRARTA-QTP-GGTGALRVAADFLAKNTSV----KRVWVS--NPSWPNHKSVFNSAGLE-VREYAYY160 (339)
T ss_pred81HHHHHHCCCCCCCCCEEEE-EEC-CCHHHHHHHHHHHHHHCCC----CEEEEC--CCCCCCHHHHHHHCCCE-EEEEECC160 (339)
T ss_dssp81HHHHCTTCHHHHTTCEEEE-EEE-HHHHHHHHHHHHHHHHSCC----CEEEEE--SSCCTTHHHHHHHTTCE-EEEECCE160 (339)
Q ss_pred161C-CCCCHHHHHHHHHHHHCCCCCCC---------EEEEEEHHHHHHHHHHHHCCCCCCEECCCCHHCC-C--CCCHHHHH240 (339)
Q d20180925_1161G-HSKDESDSKLVRFRSQQGMEIPT---------RILRISYSTFRLHAEVLLKGKVCPVICDEGHRHT-N--SDNQTNLA240 (339)
T 1G4V_A161DAENHTLDFDALINSLNEAQAGDVVLFHGCCHAPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAFQGFARGLEEDAEGLRA240 (339)
T ss_pred161CCCCCCCCHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCHHHHHHHH240 (339)
T ss_dssp161ETTTTEECHHHHHHHGGGCCTTCEEEEESSSCTTTCCCCCHHHHHHHHHHHHHHTCEEEEEECCTTSSSCHHHHTHHHHH240 (339)
Q ss_pred241HHCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCC--CC-------------HHHHHH320 (339)
Q d20180925_1241LNSFNAQRRVLISGTPILNWLLEYFSGVHIVNSIILGTAQEEKKRFEIPILKMRDAY--AS-------------DADRAL320 (339)
T 1G4V_A241FAAMHKELIVASSYSKNFGLYNERVGACTLV----AADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAI320 (339)
T ss_pred241HHHCCCCEEEEECCHHHHHHHHHHCEEEEEE----CCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCHHHHHH320 (339)
T ss_dssp241HHHHCSCEEEEEECTTTTTCGGGCEEEEEEE----CSSHHHHHHHHHHHHHHHHTTTSSCCHHHHHHHHHHHHCHHHHHH320 (339)
Q ss_pred321HHHHHHHHHHHHHCCCCCC339 (339)
Q d20180925_1321YGQKGRPMISIVNRCPIWR339 (339)
T 1G4V_A321WEQELTDMRQRIQRMRQLF339 (339)
T ss_pred321HHHHHHHHHHHHHHHHHHH339 (339)
T ss_dssp321HHHHHHHHHHHHHHHHHHH339 (339)


No 7
> 1AJS_A    Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A*     Alignment in PIR format
MAC score = 73.95	Identity = 0.08

Download partial structureDownload full-length structure
Q ss_pred1C----------CCCCCCCCCCCCCCCCCCCEEECCCCCCC------CCCCC--------CCCCCC-CCCCCCCCCCCCCC80 (355)
Q d20180925_11L----------GLRVASVRWMLHKPIKDGPLVLYPGCAIW------GHDLI--------KEDKYR-DPEPYVVDPVLSCV80 (355)
T 1AJS_A1PSVFAEVPQAQPVLVFKLIADFREDPDPRKVNLGVGAYRTDDCQPWVLPVVRKVEQRIANNSSLNHEYLPILGLA-----80 (355)
T ss_pred1CCHHHHCCCCCCCCHHHHHHHHHHCCCCCCEECCCCCEECCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCH-----80 (355)
T ss_dssp1CCTTTTCCCCCCCHHHHHHHHHHTCCCTTCEECCSCCCCCTTSCCCCCHHHHHHHHHHHTCTTCCCCCCCTTCCH-----80 (355)
Q ss_pred81CCCCCCCCEEEHHHCCCCCCCC-CCCCCEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCHHHHHHHHH160 (355)
Q d20180925_181NGVIQRGGEKFTWDCVTTRRCE-ISYGIIMADEEHLGKGLQCITPSYTLVMQDPDIKSVIDKVIVVSPASLQRNWMNESG160 (355)
T 1AJS_A81------EFRTCASRLALGDDSPALQEKRVGGV-QSLGGTGALRIGAEFLARWYNGT--NNKDTPVYVSSPTWENHNGVFT160 (355)
T ss_pred81------HHHHHHHHHHHCCCCCCCCCCCEEEE-ECCCCHHHHHHHHHHHHHCCCCC--CCCCCEEEECCCCCHHHHHHHH160 (355)
T ss_dssp81------HHHHHHHHHHHCTTCHHHHTTCEEEE-EEEHHHHHHHHHHHHHHHHSSSS--SCCCSCEEEEESCCTHHHHHHH160 (355)
Q ss_pred161HHHCCCCCEEEEECCCCCHHHH-HHHHHHHHCCCCCCCEEE----------EEEHHHHHHHHHHHHCCCCCCEECCCCHH240 (355)
Q d20180925_1161KWYGGRVQDVAIDGHSKDESDS-KLVRFRSQQGMEIPTRIL----------RISYSTFRLHAEVLLKGKVCPVICDEGHR240 (355)
T 1AJS_A161TAGFKDIRSYRYWDTEKRGLDLQGFLSDLEN-APEFSIFVLHACAHNPTGTDPTPEQWKQIASVMKRRFLFPFFDSAYQG240 (355)
T ss_pred161HCCCCEEEEEECCCCCCCCCCHHHHHHHHHH-CCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCC240 (355)
T ss_dssp161HTTCSCEEEEECEETTTTEECHHHHHHHHHH-SCTTCEEEEESSSCTTTCCCCCHHHHHHHHHHHHHHTCEEEEEESCTT240 (355)
Q ss_pred241CCC----CCCHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCCCCHHHHHHH---HHHHHHCCCCCCCC---320 (355)
Q d20180925_1241HTN----SDNQTNLALNSFNAQRRVLISGTPILNWLLEYFSGVHIVNSIILGTAQEEKKR---FEIPILKMRDAYAS---320 (355)
T 1AJS_A241FASGNLEKDAWAIRYFVSEGFELFCAQSFSKNFGLYNERV-GNLTVVA---KEPDSILRVLSQMQKIVRVTW-SNPPAQG320 (355)
T ss_pred241CCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCCCCCCCC-CEEEEEC---CCHHHHHHHHHHHHHHHHHEE-CCCCHHH320 (355)
T ss_dssp241TTTSCHHHHTHHHHHHHHTTCCEEEEEECTTTSCCGGGCE-EEEEEEC---SSHHHHHHHHHHHHHHHHTTT-SSCCSHH320 (355)
Q ss_pred321----------HHHHHHHHHHHHHHHHHHHCCCCCC355 (355)
Q d20180925_1321----------DADRALYGQKGRPMISIVNRCPIWR355 (355)
T 1AJS_A321ARIVARTLSDPELFHEWTGNVKTMADRILSMRSEL355 (355)
T ss_pred321HHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHH355 (355)
T ss_dssp321HHHHHHHHHSHHHHHHHHHHHHHHHHHHHHHHHHH355 (355)


No 8
> 4A36_B        Alignment in PIR format
MAC score = 73.5	Identity = 0.1

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEHHHCCCCCCCCCCCCCEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCC80 (292)
Q d20180925_11KEDKYRDPEPYVVDPVLSCVNGVIQRGGEKFTWDCVTTRRCEISYGIIMADEEHLGKGLQCITPSYTLVMQDPDIKSVID80 (292)
T 4A36_B1GAMETKKARSY-----------------QIELAQPAIN-----GKNALICAPTGSGKTFVSILICEHHFQNMPA-GRKAK80 (292)
T ss_pred1CCCCCCCCCHH-----------------HHHHHHHHHC-----CCCEEEECCCCCCHHHHHHHHHHHHHHHCCC-CCCCE80 (292)
T ss_dssp1UUUUCCCCCHH-----------------HHHHHHHHHT-----TCCEEEECCTTSCHHHHHHHHHHHHHTTCCS-SCCCC80 (292)
Q ss_pred81CCEEEECCCCHHHHHHHHHHHHCCCC-CEEEEECCCCCHHHHHHHHHHHHCCCCCCCEEEEEEHHHHHHHHHH-HHC--C160 (292)
Q d20180925_181KVIVVSPASLQRNWMNESGKWYGGRV-QDVAIDGHSKDESDSKLVRFRSQQGMEIPTRILRISYSTFRLHAEV-LLK--G160 (292)
T 4A36_B81VVFLATKVPVYEQQKNVFKHHFERQGYSVQGISGENFSN--VSVEKVIE------DSDIIVVTPQILVNSFEDGTLTSLS160 (292)
T ss_pred81EEEECCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCC--HHHHHHHH------CCCEEEECHHHHHHHHHCCCCCCCC160 (292)
T ss_dssp81EEEECSSHHHHHHHHHHHHHHHTTTTCCEEEECTTTGGG--SCHHHHHH------HCSEEEECHHHHHHHHHTSSCCCGG160 (292)
Q ss_pred161CCCCEECCCCHHCCCCCCHHHHHHHCC---------CCCCEEEEECCCCC-------CCHHHHHHHHHHHCC----CCCC240 (292)
Q d20180925_1161KVCPVICDEGHRHTNSDNQTNLALNSF---------NAQRRVLISGTPIL-------NWLLEYFSGVHIVNS----IILG240 (292)
T 4A36_B161IFTLMIFDECHNTTGN-HPYNVLMTRYLEQKFNSASQLPQILGLTASVGVGNAKNIEETIEHICSLCSYLDIQAISTVRE240 (292)
T ss_pred161CCEEEEEECHHHCCCC-CHHHHHHHHHHHHHHHHCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHCCCCC240 (292)
T ss_dssp161GCSEEEETTGGGCCTT-SHHHHHHHHHHHHHHHTCSCCCEEEEEESCCCCTTCSSHHHHHHHHHHHHHHTTCSEEECCCT240 (292)
Q ss_pred241CHHHHHHHHHHHH-HCCCCCCCC-HHHHHHHHHHHHHHHHHHHCCCCC---C292 (292)
Q d20180925_1241TAQEEKKRFEIPI-LKMRDAYAS-DADRALYGQKGRPMISIVNRCPIW---R292 (292)
T 4A36_B241NIQELQRFMNKPEIDVRLVKRRIHNPFAAIISNLMSETEALMRTIYSVDTLS292 (292)
T ss_pred241CCHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH292 (292)
T ss_dssp241THHHHHHHCCCCCCBCCBCCCCSCCHHHHHHHHHHHHHHHHHHTTCCUUUUU292 (292)


No 9
> 1ARH_A        Alignment in PIR format
MAC score = 73.31	Identity = 0.1

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCC------C----CC--CCCCCCCCCCCCCCCCCCCCCCCCCCCEEEHH80 (341)
Q d20180925_11LGLRVASVRWMLHKPIKDGPLVLYPGCAIWGHD------L----IK--EDKYRDPEPYVVDPVLSCVNGVIQRGGEKFTW80 (341)
T 1ARH_A1PADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYL--GI-------DGIPEFGRCTQ80 (341)
T ss_pred1CCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCC--CC-------CCCHHHHHHHH80 (341)
T ss_dssp1CCCTTHHHHHHHHHCCCTTCCBCCSSCCCCTTSCCCCCHHHHHHHHHHHHHCCCCCCC--CT-------TCCHHHHHHHH80 (341)
Q ss_pred81HCCCCCC---CCCCCCCEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCHHHHHHHHHHHHCCCCCEEE160 (341)
Q d20180925_181DCVTTRR---CEISYGIIMADEEHLGKGLQCITPSYTLVMQDPDIKSVIDKVIVVSPASLQRNWMNESGKWYGGRVQDVA160 (341)
T 1ARH_A81ELLFGKGSALINDKRARTA---QTPG-GTGALRVAADFLAKNTSV----KRV--WVSNPSWPNHKSVFNSAGLE-VREYA160 (341)
T ss_pred81HHHHHHCCCCCCCCCEEEE---EECC-CHHHHHHHHHHHHHHCCC----CEE--EECCCCCCCHHHHHHHCCCE-EEEEE160 (341)
T ss_dssp81HHHHCTTCHHHHTTCEEEE---EEEH-HHHHHHHHHHHHHHHSCC----CEE--EEEESCCTHHHHHHHHTTCE-EEEEE160 (341)
Q ss_pred161EEC-CCCCHHHHHHHHHHHHCCCCCCC---------EEEEEEHHHHHHHHHHHHCCCCCCEECCCCHHCCC---CCCHHH240 (341)
Q d20180925_1161IDG-HSKDESDSKLVRFRSQQGMEIPT---------RILRISYSTFRLHAEVLLKGKVCPVICDEGHRHTN---SDNQTN240 (341)
T 1ARH_A161YYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFARQGFARGLEEDAEGL240 (341)
T ss_pred161CCCCCCCCCCHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHH240 (341)
T ss_dssp161CEETTTTEECHHHHHHHHTTCCTTCEEEEECSSCTTTCCCCCHHHHHHHHHHHHHHTCEEEEEESCTTSSSCTTGGGHHH240 (341)
Q ss_pred241HHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCC---------------CHHHH320 (341)
Q d20180925_1241LALNSFNAQRRVLISGTPILNWLLEYFSGVHIVNSIILGTAQEEKKRFEIPILKMRDAYA---------------SDADR320 (341)
T 1ARH_A241RAFAAM-HKELIVASSYSKNFGLYNERVGACTLV---AADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALR320 (341)
T ss_pred241HHHHHC-CCCEEEEECCHHHHHHHHHHCCEEEEE---CCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCHHHH320 (341)
T ss_dssp241HHHHHH-CSCEEEEEECTTTTSCGGGCEEEEEEE---CSSHHHHHHHHHHHHHHHHTTTSSCCHHHHHHHHHHHHCHHHH320 (341)
Q ss_pred321HHHHHHHHHHHHHHHCCCCCC341 (341)
Q d20180925_1321ALYGQKGRPMISIVNRCPIWR341 (341)
T 1ARH_A321AIWEQELTDMRQRIQRMRQLF341 (341)
T ss_pred321HHHHHHHHHHHHHHHHHHHHH341 (341)
T ss_dssp321HHHHHHHHHHHHHHHHHHHHH341 (341)


No 10
> 2D7Z_A        Alignment in PIR format
MAC score = 73.18	Identity = 0.1

Download partial structureDownload full-length structure
Q ss_pred1C------CCCCCCCCCCCCCCCCCCCEEECCCCCCCCCC----------CCC--CCCCCCCCCCCCCCCCCCCCCCCCCC80 (346)
Q d20180925_11L------GLRVASVRWMLHKPIKDGPLVLYPGCAIWGHD----------LIK--EDKYRDPEPYVVDPVLSCVNGVIQRG80 (346)
T 2D7Z_A1ENITTAPADPILGLADLLRADERPGKIDLGMGVYNDETGKTPVLTSVKKAEQYLLENETTKNY--LGIDG-------IPE80 (346)
T ss_pred1CCCCCCCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCC--CCCCC-------CHH80 (346)
T ss_dssp1TTCCCCCCCTTTHHHHHHTTCCCTTCEECCSCCCCCTTSCCCCCHHHHHHHHHHHHHCCCCCC--CCTTC-------CHH80 (346)
Q ss_pred81CEEEHHHCCCCCC---CCCCCCCEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCHHHHHHHHHHHHCC160 (346)
Q d20180925_181GEKFTWDCVTTRR---CEISYGIIMADEEHLGKGLQCITPSYTLVMQDPDIKSVIDKVIVVSPASLQRNWMNESGKWYGG160 (346)
T 2D7Z_A81FGRCTQELLFGKGSALINDKRARTAQ---TP-GGTGALRVAADFLAKNTS----VK--RVWVSNPGWPTHKSVFNSAGLE160 (346)
T ss_pred81HHHHHHHHHHCCCCCCCCCCCCEEEE---EC-CCHHHHHHHHHHHHHHCC----CC--EEEECCCCCCCHHHHHHHCCCE160 (346)
T ss_dssp81HHHHHHHHHHCTTCHHHHTTCEEEEE---EE-HHHHHHHHHHHHHHHHSC----CC--EEEEEESCCHHHHHHHHHTTCE160 (346)
Q ss_pred161CCCEEEEEC-CCCCHHHHHHHHHHHHCCCCCCC---------EEEEEEHHHHHHHHHHHHCCCCCCEECCCCHHCCCCCC240 (346)
Q d20180925_1161RVQDVAIDG-HSKDESDSKLVRFRSQQGMEIPT---------RILRISYSTFRLHAEVLLKGKVCPVICDEGHRHTNSDN240 (346)
T 2D7Z_A161-VREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLE240 (346)
T ss_pred161-EEEEECCCHHCCCCCHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCC240 (346)
T ss_dssp161-EEEEECEETTTTEECHHHHHHHHTTCCTTCEEEEESSSCTTTCCCCCHHHHHHHHHHHHHHTCEEEEEESCTTSSSCTT240 (346)
Q ss_pred241HHHHHHHCC--CCCCEEEEECCCCCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCC--C-------------320 (346)
Q d20180925_1241QTNLALNSF--NAQRRVLISGTPILNWLLEYFSGVHIVNSIILGTAQEEKKRFEIPILKMRDAY--A-------------320 (346)
T 2D7Z_A241EDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLV---AADSETVDRAFSQMKAAIRVNYSSPPAHGASVVATILS320 (346)
T ss_pred241HHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHEEEEEEE---CCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHC320 (346)
T ss_dssp241GGGHHHHHHHTTCSCEEEEEECTTTSCCGGGCEEEEEEE---CSSHHHHHHHHHHHHHHHHTTTSSCCHHHHHHHHHHHH320 (346)
Q ss_pred321CHHHHHHHHHHHHHHHHHHHCCCCCC346 (346)
Q d20180925_1321SDADRALYGQKGRPMISIVNRCPIWR346 (346)
T 2D7Z_A321NDALRAIWEQELTDMRQRIQRMRQLF346 (346)
T ss_pred321CHHHHHHHHHHHHHHHHHHHHHHHHH346 (346)
T ss_dssp321CHHHHHHHHHHHHHHHHHHHHHHHHH346 (346)