TreeThreader - Results

  Job information

Job ID: d20180915
#Proteins: 4
Protein ID: d20180915_4
Fasta ID: seq4
Submission time: 2018-09-15 10:54:03 +0800
Finished time: 2019-02-17 18:32:21 +0800
Identical Job(s): NULL

  Alignments

1
50
100
126
1GNW_A 1GNW_A 1AW9_A 1AW9_A 1BYE_A 1BYE_A 1AXD_A 1AXD_A 3IBH_A 3IBH_A 1NHY_A 1NHY_A 3GX0_A 3GX0_A 3TOU_B 3TOU_B 2JL4_A 2JL4_A 3C8E_A 3C8E_A

  Build multi-template model (choose up to 5 templates)

                   
Download full-length structure

  Top 10 hits

Query:
Job ID  : d20180915_4
Length : 126
Sequence: LQTDSKNISQYAIYWEGMPVEPHFFDPRVSKLAFEQIFPSKYPLTTDEAVVAEEEAKLFKVQDVYENRLKEITYLAGMTE ILTDLHHAEAIQHLLGTPTKKLFTERMRVNEWVAEITKQPASIKVQ

No Hit MAC Score Identity Cols Query HMM Template HMM
11GNW_A73.340.71261-12657-211
21AW9_A67.590.271261-12648-207
31BYE_A640.291261-12658-206
41AXD_A61.620.281261-12657-206
53IBH_A59.060.121251-12676-226
61NHY_A55.250.171201-12685-205
73GX0_A54.540.121231-12646-203
83TOU_B51.570.151261-12655-202
92JL4_A45.930.181241-12656-205
103C8E_A45.920.131261-126108-256

  Pairwise Query-Template Alignment

No 1
> 1GNW_A    Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A*     Alignment in PIR format
MAC score = 73.34	Identity = 0.7

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCHHHHHHHHH-----------------------------HHCCCCCCCCHHHHHHHHHHHCCCCCCCCCCHHHH80 (155)
Q d20180915_41LQTDSKNISQYAIYWE-----------------------------GMPVEPHFFDPRVSKLAFEQIFPSKYPLTTDEAVV80 (155)
T 1GNW_A1FEDGDLKLFESRAITQYIAHRYENQGTNLLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTTDEAVV80 (155)
T ss_pred1EEECCEEEEEHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCCCCCCCCCCHHHH80 (155)
T ss_dssp1EEETTEEEECHHHHHHHHHHHTTTSSSCCSCSSTTCHHHHHHHHHHHHHHHHTTHHHHHHHHHHHTHHHHTTCCCCHHHH80 (155)
Q ss_pred81HHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHCCCCCCHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC155 (155)
Q d20180915_481AEEEAKLFKVQDVYENRLKEITYLAGMTEILTDLHHAEAIQHLLGTPTKKLFTERMRVNEWVAEITKQPASIKVQ155 (155)
T 1GNW_A81AEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKKLFTERPRVNEWVAEITKRPASEKVQ155 (155)
T ss_pred81HHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCHHHHHCCCHHHHHHHHHHCCCCHHHHC155 (155)
T ss_dssp81HHHHHHHHHHHHHHHHHHTTCSSSSSSSCCHHHHTTHHHHHHHTTSGGGHHHHTSHHHHHHHHHHHSSHHHHTTC155 (155)


No 2
> 1AW9_A    Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5     Alignment in PIR format
MAC score = 67.59	Identity = 0.27

Download partial structureDownload full-length structure
Q ss_pred1CCCC---------CCCHHHHHHHHHHHCCCCC---------CCCH-H-----------HHHHHHHHHC-CC---CCCCCC80 (160)
Q d20180915_41LQTD---------SKNISQYAIYWEGMPVEPH---------FFDP-R-----------VSKLAFEQIF-PS---KYPLTT80 (160)
T 1AW9_A1LNPFGQIPALVDGDEVLFESRAINRYIASKYASEGTDLLPATASAAKLEVWLEVESHHFYPNASPLVFQLLVRPLLGGAP80 (160)
T ss_pred1HCCCCCCCEEEECCEEEECHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCCHHCCCCC80 (160)
T ss_dssp1TCTTCCSCEEEETTEEEESHHHHHHHHHHHTCSSSSCSSCTTSCHHHHHHHHHHHHHTTHHHHHHHHHHHTHHHHTTCCC80 (160)
Q ss_pred81CHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHCCCCCCHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC160 (160)
Q d20180915_481DEAVVAEEEAKLFKVQDVYENRLKEITYLAGMTEILTDLHHAEAIQHLLGTPTKKLFTERMRVNEWVAEITKQPASIKVQ160 (160)
T 1AW9_A81DAAVVDKHAEQLAKVLDVYEAHLARNKYLAGDEFTLADANHASYLLYLSKTPKAGLVAARPHVKAWWEAIVARPAFQKTV160 (160)
T ss_pred81CHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCHHHHHHH160 (160)
T ss_dssp81CHHHHHHHHHHHHHHHHHHHHHHHHCSBTTBSSCCHHHHTTHHHHHHHHTSTTTHHHHTSHHHHHHHHHHHHSHHHHHHH160 (160)


No 3
> 1BYE_A        Alignment in PIR format
MAC score = 64	Identity = 0.29

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCHHHHHHHHHHHC-CCCCCC---C-------------------HHHHHHHHHHHCCCCCCCCCCHHHHHHHHHH80 (149)
Q d20180915_41LQTDSKNISQYAIYWEGMP-VEPHFF---D-------------------PRVSKLAFEQIFPSKYPLTTDEAVVAEEEAK80 (149)
T 1BYE_A1QDGDLYLFESRAICKYAARKNKPELLREGNLEEAAMVDVWIEVEANQYTAALNPILFQVLISPMLGGTTDQKVVDENLEK80 (149)
T ss_pred1EECCEEEEECCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHH80 (149)
T ss_dssp1EETTEECCSHHHHHHHHHHHHCGGGTTTTCHHHHHHHHHHHHHHHHHTHHHHHHHHHHHTHHHHHSSCCCHHHHHHHHHH80 (149)
Q ss_pred81HHHHHHHHHHHHHHCCCCCCCCCHHCCCCCCHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC149 (149)
Q d20180915_481LFKVQDVYENRLKEITYLAGMTEILTDLHHAEAIQHLLGTPTKKLFTERMRVNEWVAEITKQPASIKVQ149 (149)
T 1BYE_A81LKKVLEVYEARLTKCKYLAGDFLSLADLNHVSVTLCLFATPYASVLDAYPHVKAWWSGLMERPSVQKVA149 (149)
T ss_pred81HHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCHHHCHHHHHHHHHHHHCHHHHHHH149 (149)
T ss_dssp81HHHHHHHHHHHTTSCSSSSSSSCCHHHHTTHHHHHHHHHSTTTTGGGGCHHHHHHHHHHTTSHHHHHHH149 (149)


No 4
> 1AXD_A    Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A*     Alignment in PIR format
MAC score = 61.62	Identity = 0.28

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCHHHHHHHHHHH--CCCCCCC---C---H-H---HHHH------------HHHHHCCCCCCCCCCHHHHHHHHH80 (150)
Q d20180915_41LQTDSKNISQYAIYWEGM--PVEPHFF---D---P-R---VSKL------------AFEQIFPSKYPLTTDEAVVAEEEA80 (150)
T 1AXD_A1LQDGDLYLFESRAICKYAARKNKPELLREGNLEEAAMVDVWIEVEANQYTAALNPILFQVLISPMLGGTTDQKVVDENLE80 (150)
T ss_pred1EEECCEEEECHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHH80 (150)
T ss_dssp1EEETTEEEESHHHHHHHHHHHHCGGGGTTTCHHHHHHHHHHHHHHHHTHHHHHHHHHHHHTHHHHHTCCCCHHHHHHHHH80 (150)
Q ss_pred81HHHHHHHHHHHHHHHCCCCCCCCCHHCCCCCCHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC150 (150)
Q d20180915_481KLFKVQDVYENRLKEITYLAGMTEILTDLHHAEAIQHLLGTPTKKLFTERMRVNEWVAEITKQPASIKVQ150 (150)
T 1AXD_A81KLKKVLEVYEARLTKCKYLAGDFLSLADLNHVSVTLCLFATPYASVLDAYPHVKAWWSGLMERPSVQKVA150 (150)
T ss_pred81HHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHHHH150 (150)
T ss_dssp81HHHHHHHHHHHHHHHCSSSSSSSCCHHHHTTHHHHHHHTTSGGGGGGGGCHHHHHHHHHHHHSHHHHHHH150 (150)


No 5
> 3IBH_A    GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A*     Alignment in PIR format
MAC score = 59.06	Identity = 0.12

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCHHHHHHHHHHHCCC--CCCC-----------C-------HHHHHHHHHHHC-CC--C---CCCCCCHHHHHHH80 (152)
Q d20180915_41LQTDSKNISQYAIYWEGMPVE--PHFF-----------D-------PRVSKLAFEQIF-PS--K---YPLTTDEAVVAEE80 (152)
T 3IBH_A1ELDDGTLIAECTAITEYIDALDGTPTLTGKTPLEKGVIHMMNKRAELELLDPVSVYFHHATPGLGPEVELYQNKEWGLRQ80 (152)
T ss_pred1EECCCCEEECHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHCCCHHHHHHH80 (152)
T ss_dssp1ECTTCCEEESHHHHHHHHHHHTSCCSSSCSSHHHHHHHHHHHHHHHHHTHHHHHHHHHHHSCTTCTTTCCSCCHHHHHHH80 (152)
Q ss_pred81HHHHHHHHHHHHHHHHHCCCCCCCCCHHCCCCCCHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC152 (152)
Q d20180915_481EAKLFKVQDVYENRLKEITYLAGMTEILTDLHHAEAIQHLLGTPTKKLFTERMRVNEWVAEITKQPASIKVQ152 (152)
T 3IBH_A81RDKALHGMHYFDTVLRERPYVAGDSFSMADITVIAGLIFAAIVKL-QVPEECEALRAWYKRMQQRPSVKKLL152 (152)
T ss_pred81HHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHCC-CCCCCCHHHHHHHHHHHHCHHHHHHC152 (152)
T ss_dssp81HHHHHHHHHHHHHHHTTCSBTTBSSCCHHHHHHHHHHHHHHHTTC-CCCTTCHHHHHHHHHHHHSHHHHHHC152 (152)


No 6
> 1NHY_A    EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5     Alignment in PIR format
MAC score = 55.25	Identity = 0.17

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC80 (127)
Q d20180915_41LQTDSKNISQYAIYWEGMPVEPHFFDPRVSKLAFEQIFPSKYPLTTDEAVVAEEEAKLFKVQDVYENRLKEITYLAGMTE80 (127)
T 1NHY_A1GADDDLNAQA--QIIRWQSLANSDLCIQIANTIV--PLK--GGAPYNKKSVDSAMDAVDKIVDIFENRLKNYTYLATENI80 (127)
T ss_pred1CCCCCHHHHH--HHHHHHHHHHHHHHHHHHHHHH--HHC--CCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEECCCCC80 (127)
T ss_dssp1CCTTCHHHHH--HHHHHHHHHHTTTTGGGGGTHH--HHT--TSSCCCHHHHHHHHHHHHHHHHHHHHHHTTCSSSSSSSC80 (127)
Q ss_pred81HHCCCCCCHHHHHHHCC-CCCCCCCCCCCHHHHHHHHHCCCCCCCCC127 (127)
Q d20180915_481ILTDLHHAEAIQHLLGT-PTKKLFTERMRVNEWVAEITKQPASIKVQ127 (127)
T 1NHY_A81SLADLVAASIFTRYFESLFGTEWRAQHPAIVRWFNTVRASPFLKDEY127 (127)
T ss_pred81CHHHHHHHHHHHHHHHHHCCHHHHHHCHHHHHHHHHHHCCHHHHHHC127 (127)
T ss_dssp81CHHHHHHHHHHHHHHHHTCCHHHHHHCHHHHHHHHHHHHSTTTGGGC127 (127)


No 7
> 3GX0_A    GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli}     Alignment in PIR format
MAC score = 54.54	Identity = 0.12

Download partial structureDownload full-length structure
Q ss_pred1C----------------CCCCCCHHHHHHHHHHH-CCCCCCC--CH----HHHHHHH---HHHC---------CCCCCCC80 (161)
Q d20180915_41L----------------QTDSKNISQYAIYWEGM-PVEPHFF--DP----RVSKLAF---EQIF---------PSKYPLT80 (161)
T 3GX0_A1ISPNNKIPAIVDHSPADGGEPLSLFESGAILLYLAEKTGLFLSHETRERAATLQWLFWQVGGLGPMLGQNHHFNHAAP-Q80 (161)
T ss_pred1HCCCCCCCEEEECCCCCCCCCEEEECHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCC-C80 (161)
T ss_dssp1TCTTSCSCEEEESSCTTCCSCEEEESHHHHHHHHHHHHSCSSCSSHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHTCS-S80 (161)
Q ss_pred81CCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHCCCCCCHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCCCC160 (161)
Q d20180915_481TDEAVVAEEEAKLFKVQDVYENRLKEITYLAGMTEILTDLHHAEAIQHLLGTPTKKLFTERMRVNEWVAEITKQPASIKV160 (161)
T 3GX0_A81TIPYAIERYQVETQRLYHVLNKRLENSPWLGGENYSIADIACWPWVNAWTRQRI--DLAMYPAVKNWHERIRSRPATGQA160 (161)
T ss_pred81CCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCC--CHHHCHHHHHHHHHHHCCHHHHHH160 (161)
T ss_dssp81CCHHHHHHHHHHHHHHHHHHHHHHHHCSBTTBSSCCHHHHHHHHHHTTGGGGTC--CGGGSHHHHHHHHHHHTSHHHHHH160 (161)
Q ss_pred161C161 (161)
Q d20180915_4161Q161 (161)
T 3GX0_A161L161 (161)
T ss_pred161H161 (161)
T ss_dssp161H161 (161)


No 8
> 3TOU_B        Alignment in PIR format
MAC score = 51.57	Identity = 0.15

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCH---HHHHHHHHHHCCCCCCC----------C---HHHHHHHH--HH--HCCCC-CCCCCCHHHHHHHHHHHH80 (148)
Q d20180915_41LQTDSKNI---SQYAIYWEGMPVEPHFF----------D---PRVSKLAF--EQ--IFPSK-YPLTTDEAVVAEEEAKLF80 (148)
T 3TOU_B1VMDDGGALFDSRVIAEYADTLSPVARLIPPSGRERVEVRCWEALADGLLDAAVALRVEQTQRTPEQRSESWITRQHHKID80 (148)
T ss_pred1EECCCEEEECHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHH80 (148)
T ss_dssp1ECTTSCEECSHHHHHHHHHHHCCSSCCSCSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSCGGGCCHHHHHHHHHHHH80 (148)
Q ss_pred81HHHHHHHHHHHHCCCCCCCCCHHCCCCCCHHHHHH-HCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC148 (148)
Q d20180915_481KVQDVYENRLKEITYLAGMTEILTDLHHAEAIQHL-LGTPTKKLFTERMRVNEWVAEITKQPASIKVQ148 (148)
T 3TOU_B81EALKAMSRGLADRTWCNGNHLTLADIAVGCALAYLDFRQPQVDWREQHANLAAFYTRIEKRPSFLETQ148 (148)
T ss_pred81HHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHHHC148 (148)
T ss_dssp81HHHHHHHHHHTTCSSSSTTSCCHHHHHHHHHHHHHHHHCTTCCHHHHCHHHHHHHHHHTTSHHHHTTC148 (148)


No 9
> 2JL4_A        Alignment in PIR format
MAC score = 45.93	Identity = 0.18

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCHHHHHHHHHHHCC---CCCCC--C----HH---HHHHHHHHHC---CC------C-CCCCCCHHHHHHHHHHH80 (152)
Q d20180915_41LQTDSKNISQYAIYWEGMPV---EPHFF--D----PR---VSKLAFEQIF---PS------K-YPLTTDEAVVAEEEAKL80 (152)
T 2JL4_A1LDTGAQVLIQSPAIIEWLEEQYPTPALLPADADGRQRVRALAAIVGCDIHPINNRRILEYLRKTFGADEAAINAWCGTWI80 (152)
T ss_pred1EEECCEEEECHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHH80 (152)
T ss_dssp1EECSSCEEECHHHHHHHHHHHSCSSCSSCSSHHHHHHHHHHHHHHHHHTGGGGCHHHHHHHHHHHCCCHHHHHHHHHHHH80 (152)
Q ss_pred81HHHHHHHHHHHHHC----CCCCCCCCHHCCCCCCHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC152 (152)
Q d20180915_481FKVQDVYENRLKEI----TYLAGMTEILTDLHHAEAIQHLLGTPTKKLFTERMRVNEWVAEITKQPASIKVQ152 (152)
T 2JL4_A81SAGFDAYEALLAVDPKRGRYSFGDTPTLADCYLVPQVESARRFQVD--LTPYPLIRAVDAACGELDAFRRAA152 (152)
T ss_pred81HHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC--HHHCHHHHHHHHHHHCCHHHHHHH152 (152)
T ss_dssp81HHHHHHHHHHHHTCTTCCSSSSTTSCCHHHHHHHHHHHHHHHTTCC--CTTCHHHHHHHHHHTTSHHHHHHS152 (152)


No 10
> 3C8E_A    YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli}     Alignment in PIR format
MAC score = 45.92	Identity = 0.13

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCHHHHHHHHHHHC-CCCCCC--C----HHHHHHHH------HHHC----CC-CCCCCCCHHHHHHHHHHHHHHH80 (149)
Q d20180915_41LQTDSKNISQYAIYWEGMP-VEPHFF--D----PRVSKLAF------EQIF----PS-KYPLTTDEAVVAEEEAKLFKVQ80 (149)
T 3C8E_A1THNPPIRVFESGSILLYLAEKFGYFLPQDLAKRTETMNWLFWLQGAAPFLGGGFGHFYHYAPVKIEYAINRFTMEAKRLL80 (149)
T ss_pred1CCCCCEEEECHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHH80 (149)
T ss_dssp1TSSSCEEEESHHHHHHHHHHHHCCSSCSSHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHTCSSCCHHHHHHHHHHHHHHH80 (149)
Q ss_pred81HHHHHHHHHCCCCCCCCCHHCCCCCCHHHHHHHCCCC----C-CCCCCCCCHHHHHHHHHCCCCCCCCC149 (149)
Q d20180915_481DVYENRLKEITYLAGMTEILTDLHHAEAIQHLLGTPT----K-KLFTERMRVNEWVAEITKQPASIKVQ149 (149)
T 3C8E_A81DVLDKQLAQHKFVAGDEYTIADMAIWPWFGNVVLGGVYDAAEFLDAGSYKHVQRWAKEVGERPAVKRGR149 (149)
T ss_pred81HHHHHHHCCCCEECCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHCHHHHHHH149 (149)
T ss_dssp81HHHHHHHTTCSBTTBSSCCHHHHHHTTTHHHHHHTCSTTCTTTTTGGGCHHHHHHHHHHHTSHHHHHHT149 (149)