TreeThreader - Results

  Job information

Job ID: d20180906
#Proteins: 4
Protein ID: d20180906_4
Fasta ID: seq4
Submission time: 2018-09-06 10:54:03 +0800
Finished time: 2019-02-17 17:48:52 +0800
Identical Job(s): NULL

  Alignments

1
50
100
150
200
250
282
1ZMB_A 1ZMB_A 2APJ_A 2APJ_A 3PT5_A 3PT5_A 1FRB_A 1FRB_A 3CAS_A 3CAS_A 3DOP_A 3DOP_A 1C9W_A 1C9W_A 1XGD_A 1XGD_A 2IPJ_A 2IPJ_A 1AZ1_A 1AZ1_A

  Build multi-template model (choose up to 5 templates)

                   
Download full-length structure

  Top 10 hits

Query:
Job ID  : d20180906_4
Length : 282
Sequence: CVKSAVGLGQSNPIIRGFINSVPRICNERIQRLRNGHWQIATTPLMYDTGVRGTFFAGSFADAWSTKNQEDCIWLPRQIE GKSSIDEWSLDGLLLRHANTEPKFAHTSEELTGTLWHHGGDDVLSGNYSVYYKKPLLIIEFLRKGLNVPDERHIMGGLPM FSGKERFGKGCTCYNFINTELIKNAFEQDNVYGVTAWGLTKAGHYIHIDAIDQRKFGLNYIEAFFNRKHVTEPKVNENMQ LNLAYARLHTKAENIYIQSGDFALGYIYYSEWTAEERKIFND

No Hit MAC Score Identity Cols Query HMM Template HMM
11ZMB_A189.270.682821-2821-282
22APJ_A81.730.252181-22921-260
33PT5_A73.890.152521-28220-336
41FRB_A57.750.12662-2821-309
53CAS_A55.930.112711-2824-324
63DOP_A54.120.122681-28224-344
71C9W_A52.920.12662-2821-309
81XGD_A51.880.12621-2823-313
92IPJ_A51.870.112711-2822-319
101AZ1_A51.430.092641-2823-313

  Pairwise Query-Template Alignment

No 1
> 1ZMB_A    Acetylxylan esterase related enzyme; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.61A {Clostridium acetobutylicum} SCOP: c.23.10.7     Alignment in PIR format
MAC score = 189.27	Identity = 0.68

Download partial structureDownload full-length structure
Q ss_pred1CCCCEEEECCCCCCCCCCCCCCCCCCCCCCEEECCCCEEECCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCEEECCCCCC80 (282)
Q d20180906_41CVKSAVGLGQSNPIIRGFINSVPRICNERIQRLRNGHWQIATTPLMYDTGVRGTFFAGSFADAWSTKNQEDCIWLPRQIE80 (282)
T 1ZMB_A1MVKSFLMLGQSNMAGRGFINEVPMIYNERIQMLRNGRWQMMTEPINYDRPVSGISLAGSFADAWSQKNQEDIIGLIPCAE80 (282)
T ss_pred1CEEEEEEECCCCCCCCCCCCCCCCCCCCCEEEECCCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEECCC80 (282)
T ss_dssp1CEEEEEEEESHHHHCCBCTTSSCCCCCTTEEEEETTEEEECCSCSSCSSTTCCBCHHHHHHHHHHHSCSSSEEEEEECCC80 (282)
Q ss_pred81CCCCCCCCCCCCHHHHHHHCCCCCCCCCCCEEEEEECCCCCCCCCCCCHHHHHCHHHHHHHHHHHCCCCCCCEEECCCCC160 (282)
Q d20180906_481GKSSIDEWSLDGLLLRHANTEPKFAHTSEELTGTLWHHGGDDVLSGNYSVYYKKPLLIIEFLRKGLNVPDERHIMGGLPM160 (282)
T 1ZMB_A81GGSSIDEWALDGVLFRHALTEAKFAMESSELTGILWHQGESDSLNGNYKVYYKKLLLIIEALRKELNVPDIPIIIGGLGD160 (282)
T ss_pred81CCCCHHHHCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCC160 (282)
T ss_dssp81TTCCGGGGCTTSHHHHHHHHHHHHHHTSSEEEEEEEECCGGGSSSSCSTTHHHHHHHHHHHHHHHTTCSSSCEEEECCCT160 (282)
Q ss_pred161CCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCHHHH240 (282)
Q d20180906_4161FSGKERFGKGCTCYNFINTELIKNAFEQDNVYGVTAWGLTKAGHYIHIDAIDQRKFGLNYIEAFFNRKHVTEPKVNENMQ240 (282)
T 1ZMB_A161FLGKERFGKGCTEYNFINKELQKFAFEQDNCYFVTASGLTCNPDGIHIDAISQRKFGLRYFEAFFNRKHVLEPLINENEL240 (282)
T ss_pred161CCCCCCCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC240 (282)
T ss_dssp161TTTTSGGGTTCTTHHHHHHHHHHHHHHSTTEEEECCTTCCBCTTSSSBCHHHHHHHHHHHHHHHHHTCCBCSCCTTHHHH240 (282)
Q ss_pred241HHHHHHCCCCHHHHHHHHHCCCCCCCEEHHHHHHHHHHHHCC282 (282)
Q d20180906_4241LNLAYARLHTKAENIYIQSGDFALGYIYYSEWTAEERKIFND282 (282)
T 1ZMB_A241LNLNYARTHTKAEKIYIKSMDFALGKISYDEFTSELMKINND282 (282)
T ss_pred241CCCCCCCCEEECCEEEEEEECCCCCCEEHHHHHHHHHHHCCC282 (282)
T ss_dssp241HHHHHHSCCCHHHHHHHHHHHHHTTSSCHHHHHHHHHHHHHC282 (282)


No 2
> 2APJ_A    Putative esterase; AT4G34215, CAR esterase family 6, structural genomics, protein structure initiative, CESG; HET: SEB; 1.60A {Arabidopsis thaliana} SCOP: c.23.10.7     Alignment in PIR format
MAC score = 81.73	Identity = 0.25

Download partial structureDownload full-length structure
Q ss_pred1CCCCEEEECCCCCCCCCCCCCC---CCC-----------CC-CCCEEECCCCEEECCCCCCCC--C-CCCCCCCHHHHHH80 (251)
Q d20180906_41CVKSAVGLGQSNPIIRGFINSV---PRI-----------CN-ERIQRLRNGHWQIATTPLMYD--T-GVRGTFFAGSFAD80 (251)
T 2APJ_A1PNQIFILSGQSNMAGRGGVFKDHHNNRWVWDKILPPECAPNSSILRLSADLRWEEAHEPLHVDIDTGKVCGVGPGMAFAN80 (251)
T ss_pred1CCEEEEECCCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCEEECCCCCCCCCCCCCCCCCCHHHHHHH80 (251)
T ss_dssp1CSEEEEEEESHHHHCCBTEEECTTTCCEEECCCCCGGGCCCTTEEEECTTSCEEECCSSTTTTTSTTSCCCBCSHHHHHH80 (251)
Q ss_pred81HHHHHCC--CCEEECCCCCCCCCCCCCCCCCCHHHHHHHCCCCCC-CCCCCEEEEEECCCCCCCCCC-CCHHHHHCHHHH160 (251)
Q d20180906_481AWSTKNQ--EDCIWLPRQIEGKSSIDEWSLDGLLLRHANTEPKFA-HTSEELTGTLWHHGGDDVLSG-NYSVYYKKPLLI160 (251)
T 2APJ_A81AVKNRLETDSAVIGLVPCASGGTAIKEWERGSHLYERMVKRTEESRKCGGEIKAVLWYQGESDVLDIHDAESYGNNMDRL160 (251)
T ss_pred81HHHHHHCCCCCEEEEEECCCCCCCHHHHCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHH160 (251)
T ss_dssp81HHHHHHTCTTCCEEEEECCCTTCCGGGGSTTSHHHHHHHHHHHHHGGGSCEEEEEEEECCGGGSSSHHHHHHHHHHHHHH160 (251)
Q ss_pred161HHHHHHHCCCCCCCEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHH240 (251)
Q d20180906_4161IEFLRKGLNVPDERHIMGGLPMFSGKERFGKGCTCYNFINTELIKNAFEQDNVYGVTAWGLTKAGHYIHIDAIDQRKFGL240 (251)
T 2APJ_A161IKNLRHDLNLPSLPIIQVAIAS--G----GGY---IDKVREAQLG--LKLSNVVCVDAKGLPLKSDNLHLTTEAQVQLGL240 (251)
T ss_pred161HHHHHHHHCCCCCCEEEEEECC--C----CCH---HHHHHHHHHH--HCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHH240 (251)
T ss_dssp161HHHHHHHTTCTTCCEEEEECSC--C----CTT---HHHHHHHHHH--CCCTTEEEEECTTSCBCTTSSSBCHHHHHHHHH240 (251)
Q ss_pred241HHHHHHHHCCC251 (251)
Q d20180906_4241NYIEAFFNRKH251 (251)
T 2APJ_A241SLAQAYLSNFC251 (251)
T ss_pred241HHHHHHHHHCC251 (251)
T ss_dssp241HHHHHHHHHHC251 (251)


No 3
> 3PT5_A    NANS (YJHS), A 9-O-acetyl N-acetylneuraminic acid; SGNH hydrolase, 9-O-acetyl N-acetylneuraminic acid esterase, structural genomics; 1.60A {Escherichia coli O157}     Alignment in PIR format
MAC score = 73.89	Identity = 0.15

Download partial structureDownload full-length structure
Q ss_pred1CCCCEEEECCCCCCCCCCC---CCCCCCCCCCCEEECC-CCE----------EECCC---CCCCC---C----------C80 (347)
Q d20180906_41CVKSAVGLGQSNPIIRGFI---NSVPRICNERIQRLRN-GHW----------QIATT---PLMYD---T----------G80 (347)
T 3PT5_A1YYYVLTVAGQSNAMAYGEGLPLPDREDAPHPRIKQLARFAHTHPGGPSCHFNDIIPLTHCPHDVQDMQSYHHPLATNHQT80 (347)
T ss_pred1CCEEEEEECCCCCCCCCCCCCCHHHCCCCCCCEEEEECCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCC80 (347)
T ss_dssp1EEEEEEEEESGGGSSCBCSCCCTTTTTCCCTTEEEECCSSBSSTTSCBCCTTCEEECCSSCCCSSCCTTCCCTTCSCTTT80 (347)
Q ss_pred81CC-CCCCHHHHHHHHHHHCCC-CEEECCCCCCCCCCCCC------------------CCCCCHHHHHHHCCCC---CCCC160 (347)
Q d20180906_481VR-GTFFAGSFADAWSTKNQE-DCIWLPRQIEGKSSIDE------------------WSLDGLLLRHANTEPK---FAHT160 (347)
T 3PT5_A81QYGTVGQALHIARKLLPFIPDNAGILIVPCCRGGSAFTAGSEGTYSERHGASHDACRWGTDTPLYQDLVSRTRAALVKNP160 (347)
T ss_pred81CCCCCCHHHHHHHHHHHHCCCCCCEEEEEECCCCEECCCCCCCCCCCCCCCCCHHHHCCCCCCHHHHHHHHHHHHHHHCC160 (347)
T ss_dssp81SCSCBCTHHHHHHHHGGGSCTTEEEEEEEEECTTCBSSSSCCCCEETTTEECTTCCBCSTTSHHHHHHHHHHHHHHHTCT160 (347)
Q ss_pred161CCCEEEEEECCCCCCCCCCCCHHHHHCHHHHHHHHHHHCCC--------CCCCEEECCCCC-CCCCCCCCCCCCHHHHHH240 (347)
Q d20180906_4161SEELTGTLWHHGGDDVLSGNYSVYYKKPLLIIEFLRKGLNV--------PDERHIMGGLPM-FSGKERFGKGCTCYNFIN240 (347)
T 3PT5_A161QNKFLGVCWMQGEFDLMTSDYASHPQHFNHMVEAFRRDLKQYHSQLNNITDAPWFCGDTTWYWKEN--FP---HAYEAIY240 (347)
T ss_pred161CCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCCCCC--CC---CCHHHHH240 (347)
T ss_dssp161TCEEEEEEEECCTGGGGSTTGGGHHHHHHHHHHHHHHHHGGGGGGCCUUUCCCEEEECCCHHHHHH--CH---HHHHHHT240 (347)
Q ss_pred241HHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCHHH---HHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCCCHHHHH320 (347)
Q d20180906_4241TELIKNAFEQDNVYGVTAWGLTKAGHYIHIDAIDQ---RKFGLNYIEAFFNRKHVTEPKVNENMQLNLAYARLHTKAENI320 (347)
T 3PT5_A241GNYQN--NILANIIFVDFQQ--QGARGLTNAPDEDPDDLSTGYYGSAYRSP-E--N--WTTALRSSHF------------320 (347)
T ss_pred241HHHHH--CCCCCEEEEECCC--CCCCCCCCCHHHCCCHHHHHHCCCCEECC-C--C--CCCCCCCCCC------------320 (347)
T ss_dssp241GGGTS--CSSTTEEEECCSC--TTCCCSBSSGGGSCCBGGGTBCCGGGCCT-T--T--CSCSCGGGSB------------320 (347)
Q ss_pred321HHHHCCCCCCCEEHHHHHHHHHHHHCC347 (347)
Q d20180906_4321YIQSGDFALGYIYYSEWTAEERKIFND347 (347)
T 3PT5_A321---SSAARR-GIISDRFVEAILQFWRE347 (347)
T ss_pred321---CHHHHH-HHHHHHHHHHHHHHHHC347 (347)
T ss_dssp321---CHHHHH-THHHHHHHHHHHHHHHC347 (347)


No 4
> 1FRB_A        Alignment in PIR format
MAC score = 57.75	Identity = 0.1

Download partial structureDownload full-length structure
Q ss_pred1CCCEEEECCCCCCCCCCC-CCCC-CCCCCCCEEECCCCEEECCCCCCCCCCCCCCCCHHHHHHHHHHHCC---CCEEEC-80 (324)
Q d20180906_41VKSAVGLGQSNPIIRGFI-NSVP-RICNERIQRLRNGHWQIATTPLMYDTGVRGTFFAGSFADAWSTKNQ---EDCIWL-80 (324)
T 1FRB_A1ATFVELSTKAKMPIVGLGTWKSPPNQVKEAVKAAIDAGYRHIDCAY----AYCNENEVGEAIQEKIKEKAVQREDLFIVS80 (324)
T ss_pred1CCEEECCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHCCCCCHHHH----HHCCHHHHHHHHHHHHHCCCCCHHHEEEEC80 (324)
T ss_dssp1CCEEECTTSCEEESBCEECTTCCHHHHHHHHHHHHHTTCCEEECCG----GGTCHHHHHHHHHHHHHTTSCCGGGCEEEE80 (324)
Q ss_pred81-CCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCEEEEEECCCCCCCCC---------CCCHHHHHCHHHHHHHHHHH160 (324)
Q d20180906_481-PRQIEGKSSIDEWSLDGLLLRHANTEPKFAHTSEELTGTLWHHGGDDVLS---------GNYSVYYKKPLLIIEFLRKG160 (324)
T 1FRB_A81KLWPTCF---------EKKLLKEAFQKTLTDLKLDYLDLYLIHWPQGLQPGKELFPKDDQGRILTSKTTFLEAWEGMEEL160 (324)
T ss_pred81CCCCCCC---------CHHHHHHHHHHHHHHCCCCEEEHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH160 (324)
T ss_dssp81EECGGGC---------SHHHHHHHHHHHHHHHTCSCEEEEEECCSSCBCCSSCSSCBCTTSCBCBCSCCHHHHHHHHHHH160 (324)
Q ss_pred161CCCCCC--CEEECCCCC----CCCCCCCCCC-----CC-HHHHHHHHHHHHCCCCCCEEEEECCCC-CC---CC-CCC-C240 (324)
Q d20180906_4161LNVPDE--RHIMGGLPM----FSGKERFGKG-----CT-CYNFINTELIKNAFEQDNVYGVTAWGL-TK---AG-HYI-H240 (324)
T 1FRB_A161VDQGLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPYLTQEKLIQYCHSKGISVTAYSPLGSPDRPSAKPEDPSL240 (324)
T ss_pred161HHHCCEEEEEECCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCC240 (324)
T ss_dssp161HHTTSEEEEEEESCCHHHHHHHHTCTTCCSCCCEEEEECBTTBCCHHHHHHHHHTTCEEEEESTTCCTTSTTCCTTSCCT240 (324)
Q ss_pred241CCC---HHH-----HHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCCCHH-HHHHHHHCCCCCCCEEHHHHHHHHHH320 (324)
Q d20180906_4241IDA---IDQ-----RKFGLNYIEAFFNRKHVTEPKVNENMQLNLAYARLHTKA-ENIYIQSGDFALGYIYYSEWTAEERK320 (324)
T 1FRB_A241LEDPKIKEIAAKHEKTSAQVLIRFHIQRNVVVIPKSVTPSRIQENIQVFDFQLSDEEMATILSFNRNWR-ACLL-PETVN320 (324)
T ss_pred241CCCHHHHHHHHHHCCCHHHHHHHHHHHCCEEEECCCCCHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCC-CCCC-HHHCC320 (324)
T ss_dssp241TTCHHHHHHHHHTTCCHHHHHHHHHHTTTCEECCBCSCHHHHHHHHCCSSCCCCHHHHHHHHTTCCCCC-SCCC-GGGTT320 (324)
Q ss_pred321HHCC324 (324)
Q d20180906_4321IFND324 (324)
T 1FRB_A321MEEY324 (324)
T ss_pred321CCCC324 (324)
T ss_dssp321STTC324 (324)


No 5
> 3CAS_A        Alignment in PIR format
MAC score = 55.93	Identity = 0.11

Download partial structureDownload full-length structure
Q ss_pred1CCC-CEEEEC--CCCCCC----CCCCCCCCCC-CCCCCEEECCCCEEECCCCCCCCCCCCCCCCHHHHHHHHHHHCC---80 (332)
Q d20180906_41CVK-SAVGLG--QSNPII----RGFINSVPRI-CNERIQRLRNGHWQIATTPLMYDTGVRGTFFAGSFADAWSTKNQ---80 (332)
T 3CAS_A1SAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHID----GAYIYQNEHEVGEAIREKIAEGKVRR80 (332)
T ss_pred1CCCCCEEECCCCCCCCEEEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEH----HHHHHCCHHHHHHHHHHHHHCCCCCH80 (332)
T ss_dssp1CSSCCEEECTTSCEEESBCEECCCCTTTSCTTHHHHHHHHHHHHTCCEEE----CCGGGTCHHHHHHHHHHHHHHTSCCG80 (332)
Q ss_pred81CCEEECCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCEEEEEECCCCCCCCC---------CCCHHHHHCHHHHHH160 (332)
Q d20180906_481EDCIWLPRQIEGKSSIDEWSLDGLLLRHANTEPKFAHTSEELTGTLWHHGGDDVLS---------GNYSVYYKKPLLIIE160 (332)
T 3CAS_A81EDIFYCGKLWATNHV-------PEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWE160 (332)
T ss_pred81HHEEEECCCCCCCCC-------HHHHHHHHHHHHHHHCCCEEEHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH160 (332)
T ss_dssp81GGCEEEEEECGGGCS-------HHHHHHHHHHHHHHHTCSCEEEEEESCSCCBCCSSCSSCBCTTSCBCBCCCCHHHHHH160 (332)
Q ss_pred161HHHHHCCCC--CCCEEECCCCC----CCCCCCCCCC-----CC-HHHHHHHHHHHHCCCCCCEEEEECCCCC-CCCCCC-240 (332)
Q d20180906_4161FLRKGLNVP--DERHIMGGLPM----FSGKERFGKG-----CT-CYNFINTELIKNAFEQDNVYGVTAWGLT-KAGHYI-240 (332)
T 3CAS_A161AMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVN240 (332)
T ss_pred161HHHHHHHHCCEEEEEECCCCHHHHHHHHHCCCCCCCCCCEEECCCCCCCHHHHHHHHHHCCCEEEEECCCCCCCCCCCCC240 (332)
T ss_dssp161HHHHHHHTTSEEEEEEESCCHHHHHHHHTCTTCCSCCCEEEEECBTTBCCHHHHHHHHHTTCEEEEESTTCCCCCTTTBC240 (332)
Q ss_pred241-----CC-CC--HHH-----HHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCCCH-HHHHHHHHCCCCCC--CEEHH320 (332)
Q d20180906_4241-----HI-DA--IDQ-----RKFGLNYIEAFFNRKHVTEPKVNENMQLNLAYARLHTK-AENIYIQSGDFALG--YIYYS320 (332)
T 3CAS_A241VSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELL320 (332)
T ss_pred241CCCCCCCCCHHHHHHHHHHCCCHHHHHHHHHHHCCEEEECCCCCHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCEECCCH320 (332)
T ss_dssp241TTSCCGGGCHHHHHHHHHHTCCHHHHHHHHHHHTTCEECCBCCCHHHHHHHHCCSSCCCCHHHHHHHHTTCCCCCSBCCG320 (332)
Q ss_pred321HHHHHHHHHHCC332 (332)
Q d20180906_4321EWTAEERKIFND332 (332)
T 3CAS_A321MWRDHPEYPFHD332 (332)
T ss_pred321HHCCCCCCCCCC332 (332)
T ss_dssp321GGTTSTTCTTSS332 (332)


No 6
> 3DOP_A        Alignment in PIR format
MAC score = 54.12	Identity = 0.12

Download partial structureDownload full-length structure
Q ss_pred1CC-CCEEEEC--CCCCCC----CCCCCCCCCC-CCCCCEEECCCCEEECCCCCCCCCCCCCCCCHHHHH---HHHHHHCC80 (335)
Q d20180906_41CV-KSAVGLG--QSNPII----RGFINSVPRI-CNERIQRLRNGHWQIATTPLMYDTGVRGTFFAGSFA---DAWSTKNQ80 (335)
T 3DOP_A1SAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHI-------DGAYIYQNEHEVGEAIREKIAEGK80 (335)
T ss_pred1CCCCCEEECCCCCCCCEEEEEEEECCCCCCHHHHHHHHHHHHHCCCCEE-------HHHHHHCCHHHHHHHHHHHHHCCC80 (335)
T ss_dssp1CSSCCEEECTTSCEEESBCEECCCCGGGSCTTHHHHHHHHHHHHTCCEE-------ECCGGGTCHHHHHHHHHHHHHTTS80 (335)
Q ss_pred81---CCEEECCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCEEEEEECCCCCCCC---------CCCCHHHHHCHHH160 (335)
Q d20180906_481---EDCIWLPRQIEGKSSIDEWSLDGLLLRHANTEPKFAHTSEELTGTLWHHGGDDVL---------SGNYSVYYKKPLL160 (335)
T 3DOP_A81VRREDIFYCGKLWATNHV-------PEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCA160 (335)
T ss_pred81CCHHHEEEECCCCCCCCC-------HHHHHHHHHHHHHHHCCCEEEHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCHHH160 (335)
T ss_dssp81SCGGGCEEEEEECGGGCS-------HHHHHHHHHHHHHHHTCSCEEEEEESCSCCBCCSSCSSCBCTTCCBCBCCCCHHH160 (335)
Q ss_pred161HHHHHHHHCCCC--CCCEEECCCCC----CCCCCCCCCC-----CC-HHHHHHHHHHHHCCCCCCEEEEECCCCCC-CCC240 (335)
Q d20180906_4161IIEFLRKGLNVP--DERHIMGGLPM----FSGKERFGKG-----CT-CYNFINTELIKNAFEQDNVYGVTAWGLTK-AGH240 (335)
T 3DOP_A161TWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPI240 (335)
T ss_pred161HHHHHHHHHHHCCEEEEEECCCCHHHHHHHHHCCCCCCCCCCEEECCCCCCCHHHHHHHHHHCCCEEEEECCCCCCCCCC240 (335)
T ss_dssp161HHHHHHHHHHTTSEEEEEEESCCHHHHHHHHTCTTCCSCCCEEEEECBTTBCCHHHHHHHHHTTCEEEEESTTCCCCCTT240 (335)
Q ss_pred241-------CCCCCC--HHH-----HHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCCCH-HHHHHHHHCCCCCCC--E320 (335)
Q d20180906_4241-------YIHIDA--IDQ-----RKFGLNYIEAFFNRKHVTEPKVNENMQLNLAYARLHTK-AENIYIQSGDFALGY--I320 (335)
T 3DOP_A241WVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFV320 (335)
T ss_pred241CCCCCCCCCCCCHHHHHHHHHHCCCHHHHHHHHHHHCCEEEECCCCCHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCEEC320 (335)
T ss_dssp241TCCTTSCCGGGCHHHHHHHHHHTCCHHHHHHHHHHHTTCEECCBCCSHHHHHHHHCCSSCCCCHHHHHHHHTTCCSCCSC320 (335)
Q ss_pred321EHHHHHHHHHHHHCC335 (335)
Q d20180906_4321YYSEWTAEERKIFND335 (335)
T 3DOP_A321ELLMWRDHPEYPFHD335 (335)
T ss_pred321CCHHHCCCCCCCCCC335 (335)
T ss_dssp321CCGGGTTSTTCSSSS335 (335)


No 7
> 1C9W_A        Alignment in PIR format
MAC score = 52.92	Identity = 0.1

Download partial structureDownload full-length structure
Q ss_pred1CCCEEEECCCCCCCCC-CCCCCCC-CCCCCCEEECCCCEEECCCCCCCCCCCCCCCCHHHHHHHHHHHCC----CCEEEC80 (324)
Q d20180906_41VKSAVGLGQSNPIIRG-FINSVPR-ICNERIQRLRNGHWQIATTPLMYDTGVRGTFFAGSFADAWSTKNQ----EDCIWL80 (324)
T 1C9W_A1STFVELSTKAKMPIVGLGTWQSPPGQVKEAVKVAIDAGYRHIDCA----YAYYNEHEVGEAIQEKIKEKAVRREDLFIVS80 (324)
T ss_pred1CCEEECCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHCCCCCHHH----HHHCCHHHHHHHHHHHHHCCCCCHHHEEEEC80 (324)
T ss_dssp1CCEEECTTSCEEESBCBBCTTCCHHHHHHHHHHHHHHTCCEEECC----GGGSCHHHHHHHHHHHHHHTSSCGGGCEEEE80 (324)
Q ss_pred81-CCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCEEEEEECCCCCCCCC---------CCCHHHHHCHHHHHHHHHHH160 (324)
Q d20180906_481-PRQIEGKSSIDEWSLDGLLLRHANTEPKFAHTSEELTGTLWHHGGDDVLS---------GNYSVYYKKPLLIIEFLRKG160 (324)
T 1C9W_A81KLWPTCF-------E-R-KLLKEAFQKTLTDLKLDYLDLYLIHWPQGLQPGKELFPKDDQGNVLTSKITFLDAWEVMEEL160 (324)
T ss_pred81CCCCCCC-------C-H-HHHHHHHHHHHHHCCCCEEEHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH160 (324)
T ss_dssp81EECGGGC-------S-H-HHHHHHHHHHHHHHTCSCBSEEEESCSSCBCCSSCSSCBCSSCCBCBCSCCHHHHHHHHHHH160 (324)
Q ss_pred161CCCCCCC-EEECCCCC-----CCCCCCCCCC-----CC-HHHHHHHHHHHHCCCCCCEEEEECCCCCC----CC--CCCC240 (324)
Q d20180906_4161LNVPDER-HIMGGLPM-----FSGKERFGKG-----CT-CYNFINTELIKNAFEQDNVYGVTAWGLTK----AG--HYIH240 (324)
T 1C9W_A161VDEGLVKALGVSNFNHFQIERILNKPGLKHKPVTNQVECHPYLTQEKLIEYCHSKGITVTAYSPLGSPNRPWAKPEDPSL240 (324)
T ss_pred161HHHCCEEEEEECCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCC240 (324)
T ss_dssp161HHTTSBSCEEEESCCHHHHHHHHTCTTCCCCCCEEEEECBTTBCCHHHHHHHHHTTCEEEEECTTCCTTSSSCCTTSCCT240 (324)
Q ss_pred241CCC---HHH-----HHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCCCH-HHHHHHHHCCCCCCCEEHHHHHHHHHH320 (324)
Q d20180906_4241IDA---IDQ-----RKFGLNYIEAFFNRKHVTEPKVNENMQLNLAYARLHTK-AENIYIQSGDFALGYIYYSEWTAEERK320 (324)
T 1C9W_A241LEDPKIKEIAAKHKKTSAQVLIRFHIQRNVVVIPKSVTPARIHENFQVFDFQLSDQEMATILGFNRNWR-ACL-LPETVN320 (324)
T ss_pred241CCCHHHHHHHHHHCCCHHHHHHHHHHHCCEEEECCCCCHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCC-CCC-CHHHCC320 (324)
T ss_dssp241TTCHHHHHHHHHTTCCHHHHHHHHHHTTTCEECCBCSCHHHHHHHTCCSSCCCCHHHHHHHHTTCCCCC-SSC-CGGGSS320 (324)
Q ss_pred321HHCC324 (324)
Q d20180906_4321IFND324 (324)
T 1C9W_A321MEEY324 (324)
T ss_pred321CCCC324 (324)
T ss_dssp321STTC324 (324)


No 8
> 1XGD_A        Alignment in PIR format
MAC score = 51.88	Identity = 0.1

Download partial structureDownload full-length structure
Q ss_pred1CC------CCEEEECCCCCCCCCCCCCCCCCCCCCCEEECCCCEEECCCCCCCCCCCCCCCCHHHHHHHHHHHCC---CC80 (331)
Q d20180906_41CV------KSAVGLGQSNPIIRGFINSVPRICNERIQRLRNGHWQIATTPLMYDTGVRGTFFAGSFADAWSTKNQ---ED80 (331)
T 1XGD_A1RLLLNNGAKMPILGLGTW-----KSP--PGQVTEAVKVAIDVGYRHIDCAHV----YQNENEVGVAIQEKLREQVVKREE80 (331)
T ss_pred1EEECCCCCCCCCEEEEEE-----ECC--HHHHHHHHHHHHHHCCCEEHHHHH----HCCHHHHHHHHHHHHHCCCCCHHH80 (331)
T ss_dssp1EEECTTSCEEESBEEECT-----TCC--HHHHHHHHHHHHHHTCCEEECCGG----GTCHHHHHHHHHHHHHTTSSCGGG80 (331)
Q ss_pred81EEEC--CCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCEEEEEECC--CCCCCC-----C--CCCHHHHHCHHHHHH160 (331)
Q d20180906_481CIWL--PRQIEGKSSIDEWSLDGLLLRHANTEPKFAHTSEELTGTLWHH--GGDDVL-----S--GNYSVYYKKPLLIIE160 (331)
T 1XGD_A81LFIVSKLWCTYH--------EKGLVKGACQKTLSD-LKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWA160 (331)
T ss_pred81EEEECCCCCCCC--------CHHHHHHHHHHHHHH-CCCCEEEHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH160 (331)
T ss_dssp81CEEEEEECGGGC--------SGGGHHHHHHHHHHH-HTCSCBSEEEESCSCCBCCSSCSSCBCTTSCBCBCCCCHHHHHH160 (331)
Q ss_pred161HHHHHCCCCCC--CEEECCCCC----CCCCCCCCCC-----CC-HHHHHHHHHHHHCCCCCCEEEEECCCCCCC------240 (331)
Q d20180906_4161FLRKGLNVPDE--RHIMGGLPM----FSGKERFGKG-----CT-CYNFINTELIKNAFEQDNVYGVTAWGLTKA------240 (331)
T 1XGD_A161AMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKP240 (331)
T ss_pred161HHHHHHHHCCEEEEEECCCCHHHHHHHHHCCCCCCCCCCEEEECCCCCCHHHHHHHHHHCCCEEEEECCCCCCCCCCCCC240 (331)
T ss_dssp161HHHHHHHTTSBSCEEEESCCHHHHHHHHTCTTCCCCCSEEEEECBTTBCCHHHHHHHHHTTCEEEEECTTCCSCCTTCCT240 (331)
Q ss_pred241-CCCCCCCC--HHH-----HHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCCCHH-HHHHHHHCCCCCC--CEEHHH320 (331)
Q d20180906_4241-GHYIHIDA--IDQ-----RKFGLNYIEAFFNRKHVTEPKVNENMQLNLAYARLHTKA-ENIYIQSGDFALG--YIYYSE320 (331)
T 1XGD_A241EDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPEAIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLS320 (331)
T ss_pred241CCCCCCCCHHHHHHHHHHCCCHHHHHHHHHHHCCEEEECCCCCHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCCCCCCHH320 (331)
T ss_dssp241TSCCGGGCHHHHHHHHHHTCCHHHHHHHHHHTTTCEEECCCCSHHHHHHHHCCSSCCCCHHHHHHHHTTCCCCCSCCCGG320 (331)
Q ss_pred321HHHHHHHHHCC331 (331)
Q d20180906_4321WTAEERKIFND331 (331)
T 1XGD_A321CTSHKDYPFHE331 (331)
T ss_pred321HCCCCCCCCCC331 (331)
T ss_dssp321GTTSTTCGGGS331 (331)


No 9
> 2IPJ_A        Alignment in PIR format
MAC score = 51.87	Identity = 0.11

Download partial structureDownload full-length structure
Q ss_pred1CCCCEEE-ECCCCCCCCCCC---CCCCC-CCCCCCEEECCCCEEECCCCCCCCCCCCCCCCHHHHHHHHHHHCC---CCE80 (329)
Q d20180906_41CVKSAVG-LGQSNPIIRGFI---NSVPR-ICNERIQRLRNGHWQIATTPLMYDTGVRGTFFAGSFADAWSTKNQ---EDC80 (329)
T 2IPJ_A1KYQCVKLNDGHFMPVLGFGTAAPAEVPKSKALEAVKLAIEAGFHHIDS----AHVYNNEEQVGLAIRSKIADGSVKREDI80 (329)
T ss_pred1CCCEEECCCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCCCHH----HHHHCCHHHHHHHHHHHHHCCCCCHHHE80 (329)
T ss_dssp1CCCEEECTTSCEEESEEEECCCCTTSCTHHHHHHHHHHHHHTCCEEEC----CGGGTCHHHHHHHHHHHHHTTSCCGGGC80 (329)
Q ss_pred81EECCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCEEEEEECCCCCCCCC---------CCCHHHHHCHHHHHHHHH160 (329)
Q d20180906_481IWLPRQIEGKSSIDEWSLDGLLLRHANTEPKFAHTSEELTGTLWHHGGDDVLS---------GNYSVYYKKPLLIIEFLR160 (329)
T 2IPJ_A81FYTSKLWS-----NSHR--PELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAME160 (329)
T ss_pred81EEECCCCC-----CCCC--HHHHHHHHHHHHHHCCCCEEEHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH160 (329)
T ss_dssp81EEEEEECG-----GGCS--HHHHHHHHHHHHHHHTCSCEEEEEECCSSCBCSSSCSSCBCTTSCBCBCCCCHHHHHHHHH160 (329)
Q ss_pred161HHCCCC--CCCEEECCCC----CCCCCCCCCCC-----CC-HHHHHHHHHHHHCCCCCCEEEEECCCCCCC-C-------240 (329)
Q d20180906_4161KGLNVP--DERHIMGGLP----MFSGKERFGKG-----CT-CYNFINTELIKNAFEQDNVYGVTAWGLTKA-G-------240 (329)
T 2IPJ_A161KCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNS240 (329)
T ss_pred161HHHHHCCEEEEEECCCCHHHHHHHHHCCCCCCCCCCEEEECCCCCCHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCC240 (329)
T ss_dssp161HHHHTTSEEEEEEESCCHHHHHHHHTCTTCCCCCSEEEEECBTTBCCHHHHHHHHHTTCEEEEESTTCCCCCTTTSCTTS240 (329)
Q ss_pred241CCCCCCC--HHH-----HHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCCCHH-HHHHHHHCCCCCC--CEEHHHHH320 (329)
Q d20180906_4241HYIHIDA--IDQ-----RKFGLNYIEAFFNRKHVTEPKVNENMQLNLAYARLHTKA-ENIYIQSGDFALG--YIYYSEWT320 (329)
T 2IPJ_A241PVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFA320 (329)
T ss_pred241CCCCCCHHHHHHHHHHCCCHHHHHHHHHHHCCEEEECCCCCHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCEECCCHHHC320 (329)
T ss_dssp241CCGGGCHHHHHHHHHHTSCHHHHHHHHHHHTTCEEEEECCCHHHHHHHGGGGGCCCCHHHHHHHHTTCCCCCSCCCGGGC320 (329)
Q ss_pred321HHHHHHHCC329 (329)
Q d20180906_4321AEERKIFND329 (329)
T 2IPJ_A321GPPNYPFSD329 (329)
T ss_pred321CCCCCCCCC329 (329)
T ss_dssp321SSTTCSSSS329 (329)


No 10
> 1AZ1_A        Alignment in PIR format
MAC score = 51.43	Identity = 0.09

Download partial structureDownload full-length structure
Q ss_pred1CC------CCEEEECCCCCCCCCCCCCCCCCCCCCCEEECCCCEEECCCCCCCCCCCCCCCCHHHHHHHHHHHCC---CC80 (329)
Q d20180906_41CV------KSAVGLGQSNPIIRGFINSVPRICNERIQRLRNGHWQIATTPLMYDTGVRGTFFAGSFADAWSTKNQ---ED80 (329)
T 1AZ1_A1RLLLNNGAKMPILGLGTW-----KS--PPGQVTEAVKVAIDVGYRHIDCAHV----YQNENEVGVAIQEKLREQVVKREE80 (329)
T ss_pred1EEECCCCCCCCCEEEEEE-----EC--CHHHHHHHHHHHHHCCCCEEHHHHH----HCCHHHHHHHHHHHHHCCCCCHHH80 (329)
T ss_dssp1EEECTTSCEEESBCEECT-----TC--CHHHHHHHHHHHHHHTCCEEECCGG----GTCHHHHHHHHHHHHHTTSSCGGG80 (329)
Q ss_pred81EEECCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCEEEEEECCCCCCCC------C---CCCHHHHHCHHHHHHHH160 (329)
Q d20180906_481CIWLPRQIEGKSSIDEWSLDGLLLRHANTEPKFAHTSEELTGTLWHHGGDDVL------S---GNYSVYYKKPLLIIEFL160 (329)
T 1AZ1_A81LFIVSKLWCT-----YHE-KGLVKGACQKTLSD-LKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAM160 (329)
T ss_pred81EEEECCCCCC-----CCC-HHHHHHHHHHHHHH-CCCCEEEHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHH160 (329)
T ss_dssp81CEEEEEECGG-----GCS-HHHHHHHHHHHHHH-HTCSCBSEEEECCSCCBCCSSCSSCBCTTSCBCBCSCCHHHHHHHH160 (329)
Q ss_pred161HHHCCCC--CCCEEECCCCC----CCCCCCCCCC-----CC-HHHHHHHHHHHHCCCCCCEEEEECCCC-CCCC----CC240 (329)
Q d20180906_4161RKGLNVP--DERHIMGGLPM----FSGKERFGKG-----CT-CYNFINTELIKNAFEQDNVYGVTAWGL-TKAG----HY240 (329)
T 1AZ1_A161EELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPYAKPED240 (329)
T ss_pred161HHHHHHCCEEEEEECCCCHHHHHHHHHCCCCCCCCCCEEEECCCCCCHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCC240 (329)
T ss_dssp161HHHHHHTSBSCEEEESCCHHHHHHHHTCTTCCSCCCEEEEECBTTBCCHHHHHHHHHTTCEEEEESTTCCTTSSCCCSSC240 (329)
Q ss_pred241C-CCCCHH---H-----HHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCCCH-HHHHHHHHCCCCCCC--EEHHHHH320 (329)
Q d20180906_4241I-HIDAID---Q-----RKFGLNYIEAFFNRKHVTEPKVNENMQLNLAYARLHTK-AENIYIQSGDFALGY--IYYSEWT320 (329)
T 1AZ1_A241PSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVAALLSCT320 (329)
T ss_pred241CCCCCCHHHHHHHHHHCCCHHHHHHHHHHHCCEEEECCCCCHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCCCCCCHHHC320 (329)
T ss_dssp241CCSTTCHHHHHHHHHTTSCHHHHHHHHHHTTTCEECCBCCCHHHHHHHHCCSSCCCCHHHHHHHHTTCCCCCSCCCGGGT320 (329)
Q ss_pred321HHHHHHHCC329 (329)
Q d20180906_4321AEERKIFND329 (329)
T 1AZ1_A321SHKDYPFHE329 (329)
T ss_pred321CCCCCCCCC329 (329)
T ss_dssp321TSTTCSSSS329 (329)