TreeThreader - Results

  Job information

Job ID: HAMP_TM_310
#Proteins: 96
Protein ID: HAMP_TM_310_23
Fasta ID: |WP_043188019.1|/189-303
Submission time: 2018-07-18 22:44:40 +0800
Finished time: 2019-02-17 13:00:08 +0800
Identical Job(s): NULL

  Alignments

1
50
100
115
3OID_D 3OID_D 3GK3_A 3GK3_A 2PD6_A 2PD6_A 1S0P_A 1S0P_A 2X72_A 2X72_A 3D0S_A 3D0S_A 1KG6_A 1KG6_A 2KTB_B 2KTB_B 1KG2_A 1KG2_A 1KG4_A 1KG4_A

  Build multi-template model (choose up to 5 templates)

                   
Download full-length structure

  Top 10 hits

Query:
Job ID  : HAMP_TM_310_23
Length : 115
Sequence: MGLSWQQRGIKRLLKLADQTTSDPLIAQMYTDSRGAQARLEMAILSQEARLKTCLTRLQDTAEHLTGQARQSDALAHQSS QGLERQRLETEQVAAAVNQMAATTQEVASHVQRTA

No Hit MAC Score Identity Cols Query HMM Template HMM
13OID_D34.920.161131-11560-176
23GK3_A33.480.061101-11578-197
32PD6_A33.080.141111-11566-187
41S0P_A32.30.081121-11532-159
52X72_A32.190.121141-115149-277
63D0S_A32.030.11141-1159-172
71KG6_A31.840.131041-1151-104
82KTB_B31.490.121111-1155-119
91KG2_A31.450.131041-1151-104
101KG4_A31.440.131041-1151-104

  Pairwise Query-Template Alignment

No 1
> 3OID_D        Alignment in PIR format
MAC score = 34.92	Identity = 0.16

Download partial structureDownload full-length structure
Q ss_pred1CCHHHHHHHHHHHHHHHHHHCCCHHHHHHHCCCCC---C-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH80 (119)
Q HAMP_TM_310_231MGLSWQQRGIKRLLKLADQTTSDPLIAQMYTDSRG---A-QARLEMAILSQEARLKTCLTRLQDTAEHLTGQARQSDALA80 (119)
T 3OID_D1KANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEK-N-GGGHIV80 (119)
T ss_pred1ECCCCCHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH-C-CCEEEE80 (119)
T ss_dssp1ECCTTCHHHHHHHHHHHHHHHSCCCEEEECCCCCCCSCGGGCCHHHHHHHHHHHTHHHHHHHHHHHHHHGG-G-TCEEEE80 (119)
Q ss_pred81HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC119 (119)
Q HAMP_TM_310_2381HQSSQGLERQRLETEQVAAAVNQMAATTQEVASHVQRTA119 (119)
T 3OID_D81SISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSPKQ119 (119)
T ss_pred81EECCHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHC119 (119)
T ss_dssp81EEEEGGGTSBCTTCHHHHHHHHHHHHHHHHHHHHTGGGT119 (119)


No 2
> 3GK3_A    Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase; 2.10A {Burkholderia pseudomallei 1710B}     Alignment in PIR format
MAC score = 33.48	Identity = 0.06

Download partial structureDownload full-length structure
Q ss_pred1CCHH---HHHHHHHHHHHHHHHHCCCHHHHHHHCC-------CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH80 (125)
Q HAMP_TM_310_231MGLS---WQQRGIKRLLKLADQTTSDPLIAQMYTD-------SRGAQARLEMAILSQEARLKTCLTRLQDTAEHLTGQAR80 (125)
T 3GK3_A1KAYAVDVADFESCERCAEKVLADFGKVDVLINNAGITRDATFMKMTKGDWDAVMRTDLDAMFNVTKQFIAGMVERR----80 (125)
T ss_pred1EEEEECCCCHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC----80 (125)
T ss_dssp1EEEECCTTCHHHHHHHHHHHHHHHSCCSEEEECCCCCCCBCTTTCCHHHHHHHHHHHTHHHHHHHHHHHHHHHHHT----80 (125)
Q ss_pred81HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC125 (125)
Q HAMP_TM_310_2381QSDALAHQSSQGLERQRLETEQVAAAVNQMAATTQEVASHVQRTA125 (125)
T 3GK3_A81-FGRIVNIGSVNGSRGAFGQANYASAKAGIHGFTKTLALETAKRG125 (125)
T ss_pred81-CCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHC125 (125)
T ss_dssp81-CEEEEEECCHHHHHCCTTBHHHHHHHHHHHHHHHHHHHHHGGGT125 (125)


No 3
> 2PD6_A    Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} SCOP: c.2.1.0     Alignment in PIR format
MAC score = 33.08	Identity = 0.14

Download partial structureDownload full-length structure
Q ss_pred1CC---HHHHHHHHHHHHHHHHHHCCCHHHHHHHCC----CCC----CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH80 (126)
Q HAMP_TM_310_231MG---LSWQQRGIKRLLKLADQTTSDPLIAQMYTD----SRG----AQARLEMAILSQEARLKTCLTRLQDTAEHLTGQA80 (126)
T 2PD6_A1AAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQA---LVSN-80 (126)
T ss_pred1EEEEEECCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH---HHHC-80 (126)
T ss_dssp1EEEECCTTSHHHHHHHHHHHHHHHSSCCSEEEECCCCCCCBCGGGCCHHHHHHHHHHHTHHHHHHHHHHHHH---HHHH-80 (126)
Q ss_pred81HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC126 (126)
Q HAMP_TM_310_2381RQSDALAHQSSQGLERQRLETEQVAAAVNQMAATTQEVASHVQRTA126 (126)
T 2PD6_A81GCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHG126 (126)
T ss_pred81CCCEEEEEECCHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHC126 (126)
T ss_dssp81TCCEEEEEECCTHHHHCCTTBHHHHHHHHHHHHHHHHHHHHHGGGT126 (126)


No 4
> 1S0P_A    CAP, adenylyl cyclase-associated protein; alpha helix bundle, membrane protein; 1.40A {Dictyostelium discoideum} SCOP: a.192.1.1 PDB: 1tjf_A     Alignment in PIR format
MAC score = 32.3	Identity = 0.08

Download partial structureDownload full-length structure
Q ss_pred1CCHHHHHHHHHHHHHHHHHHCCCH----------------HHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH80 (131)
Q HAMP_TM_310_231MGLSWQQRGIKRLLKLADQTTSDP----------------LIAQMYTDSRGAQARLEMAILSQEARLKTCLTRLQDTAEH80 (131)
T 1S0P_A1EQLVKAIDAEKALINTASQSKKPSQETLLELIKPLNNFAAEVGKIRDSNRSSKFFNNLSAISESIGFLSWVVVEPTPGPH80 (131)
T ss_pred1HHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHEEHCCCCCHHHH80 (131)
T ss_dssp1HHHHHHHHHHHHHHHHHHHEECCCHHHHHHHTHHHHHHHHHHHHHHHTCTTCTTHHHHHHHHTSGGGGGGGGCCSCHHHH80 (131)
Q ss_pred81HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC131 (131)
Q HAMP_TM_310_2381LTGQARQSDALAHQSSQGLERQRLETEQVAAAVNQMAATTQEVASHVQRTA131 (131)
T 1S0P_A81VAEMRGSAEFYTNRILKEFKG---VNQDQVDWVSNYVNFLKDLEKYIKQYH131 (131)
T ss_pred81HHHHHHHHHHHHHHHHHHHHH---CCCHHHHHHHHHHHHHHHHHHHHHHHC131 (131)
T ss_dssp81HHHHHHHHHHHHHHHHHHHTT---TCHHHHHHHHHHHHHHHHHHHHHHHHS131 (131)


No 5
> 2X72_A        Alignment in PIR format
MAC score = 32.19	Identity = 0.12

Download partial structureDownload full-length structure
Q ss_pred1CCHHHHHHHHHHHHHHHHHHCC-----------C---HHHHHH-HCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH80 (130)
Q HAMP_TM_310_231MGLSWQQRGIKRLLKLADQTTS-----------D---PLIAQM-YTDSRGAQARLEMAILSQEARLKTCLTRLQDTAEHL80 (130)
T 2X72_A1FGENHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNN-ESFVIYMFVVHFIIPLIVIFFCYGQL80 (130)
T ss_pred1CCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCC-CEEEEHHHHHHHHHHHHHHHHHHHHH80 (130)
T ss_dssp1CCHHHHHHHHHHHHHHHHHHHSGGGGTSSCEEEETTTTEEEECCSSCCTTTTH-HHHHHHHHHHHTHHHHHHHHHHHHHH80 (130)
Q ss_pred81HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC130 (130)
Q HAMP_TM_310_2381TGQARQSDALAHQSSQGLERQRLETEQVAAAVNQMAATTQEVASHVQRTA130 (130)
T 2X72_A81VFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIF130 (130)
T ss_pred81HHHHHHHHHHHHHHHHHHHHHHHHHEEEHHHHHHHHHHHHHHHHHHHHHH130 (130)
T ss_dssp81HHHHHHHHHTTTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH130 (130)


No 6
> 3D0S_A    Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 4a2u_A* 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A*     Alignment in PIR format
MAC score = 32.03	Identity = 0.1

Download partial structureDownload full-length structure
Q ss_pred1CCHHH----HHHHHHHHHHHHH--------HHCCC-------------------------HHHHHHHCC----------C80 (165)
Q HAMP_TM_310_231MGLSW----QQRGIKRLLKLAD--------QTTSD-------------------------PLIAQMYTD----------S80 (165)
T 3D0S_A1ARAGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFD80 (165)
T ss_pred1HCCCHHCCCCHHHHHHHHHHCEEEEECCCCEEECCCCCCCEEEEEEEEEEEEEEECCCCCEEEEEEECCCCEEEEHHHHC80 (165)
T ss_dssp1TTSSTTSSCCSSTTHHHHTTSCEEEECTTCEEECTTCCCCEEEEEEESCEEEEEECTTSCEEEEEEECTTCEESCHHHHS80 (165)
Q ss_pred81CC---CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH160 (165)
Q HAMP_TM_310_2381RG---AQARLEMAILSQEARLKTCLTRLQDTAEHLTGQARQSDALAHQSSQGLERQRLETEQVAAAVNQMAATTQEVASH160 (165)
T 3D0S_A81PGPRTSSATTITEVRAVSMDRD-ALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQ160 (165)
T ss_pred81CCCCCEEEEECCCEEEEEECHH-HHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCC160 (165)
T ss_dssp81CSCCSSEEEESSCEEEEEEEHH-HHHHTTSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHEEE160 (165)
Q ss_pred161HHHCC165 (165)
Q HAMP_TM_310_23161VQRTA165 (165)
T 3D0S_A161EGGAL165 (165)
T ss_pred161CCCCE165 (165)
T ss_dssp161ETTEE165 (165)


No 7
> 1KG6_A        Alignment in PIR format
MAC score = 31.84	Identity = 0.13

Download partial structureDownload full-length structure
Q ss_pred1CCHHHHHHHHHHHHHHHHHHCCCHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH80 (115)
Q HAMP_TM_310_231MGLSWQQRGIKRLLKLADQTTSDPLIAQMYTDSRGAQARLEMAILSQEARLKTCLTRLQDTAEHLTGQARQSDALAHQSS80 (115)
T 1KG6_A1MQ---ASQFSAQVLDWYDKYGRKTLPWQ---I-DKTPYKVWLSEVML---QQTQVATVIPYFERFMARFPTVTDLANAPL80 (115)
T ss_pred1CC---HHHHHHHHHHHHHHHCCCCCCCC---C-CCCHHHHHHHHHHH---HHCCCCHHHHHHHHHHHHCCCHHHHHHCCH80 (115)
T ss_dssp1CC---HHHHHHHHHHHHHHHSCCCSGGG---S-SCCHHHHHHHHHHH---TSSCHHHHHHHHHHHHHHCSSHHHHHHSCH80 (115)
Q ss_pred81HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC115 (115)
Q HAMP_TM_310_2381QGLERQRLETEQVAAAVNQMAATTQEVASHVQRTA115 (115)
T 1KG6_A81DEVLHLWTGLGYY-ARARNLHKAAQQVATLHGGKF115 (115)
T ss_pred81HHHHHHHHCCCCH-HHHHHHHHHHHHHHHHHCCCC115 (115)
T ss_dssp81HHHHHHHTTSCCT-HHHHHHHHHHHHHHHHSTTSC115 (115)


No 8
> 2KTB_B        Alignment in PIR format
MAC score = 31.49	Identity = 0.12

Download partial structureDownload full-length structure
Q ss_pred1CCHHHHHHHHHHHHHHHHHHCC---CHHHHHHH-CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH80 (119)
Q HAMP_TM_310_231MGLSWQQRGIKRLLKLADQTTS---DPLIAQMY-TDSRGAQARLEMAILSQEARLKTCLTRLQDTAEHLTGQARQSDALA80 (119)
T 2KTB_B1SSPAYLKEILEQLLEAIVVATNPSGRLISELFQKLPSKVQYPDYYAII-KEPIDLKTIAQRIQN---GSYKSIHAMAKDI80 (119)
T ss_pred1CCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHCCCCHHHCCCHHHHH-CCCCCHHHHHHHHHC---CCCCCHHHHHHHH80 (119)
T ss_dssp1SSHHHHHHHHHHHHHHHHHCCCTTSSCSGGGGSCCCCSSSCHHHHHHC-SSCCCHHHHHHHHHT---TSCSSHHHHHHHH80 (119)
Q ss_pred81HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC119 (119)
Q HAMP_TM_310_2381HQSSQGLERQRLETEQVAAAVNQMAATTQEVASHVQRTA119 (119)
T 2KTB_B81DLLAKNAKTYNEPGSQVFKDANSIKKIFYMKKAEIEHHE119 (119)
T ss_pred81HHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHCCHHH119 (119)
T ss_dssp81HHHHHHHHHHSCTTSHHHHHHHHHHHHHHHHHHHHHHHT119 (119)


No 9
> 1KG2_A    A/G-specific adenine glycosylase; DNA repair, hydrolase; 1.20A {Escherichia coli} SCOP: a.96.1.2 PDB: 1kg3_A 1muy_A 1kg6_A 1kg5_A 1mun_A 1mud_A 1kg4_A 1weg_A 1wei_A* 1wef_A* 1kg7_A 1kqj_A     Alignment in PIR format
MAC score = 31.45	Identity = 0.13

Download partial structureDownload full-length structure
Q ss_pred1CCHHHHHHHHHHHHHHHHHHCCCHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH80 (115)
Q HAMP_TM_310_231MGLSWQQRGIKRLLKLADQTTSDPLIAQMYTDSRGAQARLEMAILSQEARLKTCLTRLQDTAEHLTGQARQSDALAHQSS80 (115)
T 1KG2_A1MQA---SQFSAQVLDWYDKYGRKTLPWQ---I-DKTPYKVWLSEVM---LQQTQVATVIPYFERFMARFPTVTDLANAPL80 (115)
T ss_pred1CCH---HHHHHHHHHHHHHHCCCCCCCC---C-CCCHHHHHHHHHH---HCCCCHHHHHHHHHHHHHHCCCHHHHHCCCH80 (115)
T ss_dssp1CCH---HHHHHHHHHHHHHHCCCCSGGG---S-SCCHHHHHHHHHH---HTSSCHHHHHHHHHHHHHHCSSHHHHHHSCH80 (115)
Q ss_pred81HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC115 (115)
Q HAMP_TM_310_2381QGLERQRLETEQVAAAVNQMAATTQEVASHVQRTA115 (115)
T 1KG2_A81DEVLHLWTGLGYY-ARARNLHKAAQQVATLHGGKF115 (115)
T ss_pred81HHHHHHHHCCCHH-HHHHHHHHHHHHHHHHCCCCC115 (115)
T ss_dssp81HHHHHHHTTSCCT-HHHHHHHHHHHHHHHHSTTSC115 (115)


No 10
> 1KG4_A        Alignment in PIR format
MAC score = 31.44	Identity = 0.13

Download partial structureDownload full-length structure
Q ss_pred1CCHHHHHHHHHHHHHHHHHHCCCHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH80 (115)
Q HAMP_TM_310_231MGLSWQQRGIKRLLKLADQTTSDPLIAQMYTDSRGAQARLEMAILSQEARLKTCLTRLQDTAEHLTGQARQSDALAHQSS80 (115)
T 1KG4_A1MQA---SQFSAQVLDWYDKYGRKTLPWQ---I-DKTPYKVWLSEVML---QQTQVATVIPYFERFMARFPTVTDLANAPL80 (115)
T ss_pred1CCH---HHHHHHHHHHHHHHCCCCCCCC---C-CCCHHHHHHHHHHH---HHCCCCHHHHHHHHHHHHCCCHHHHHHCCH80 (115)
T ss_dssp1CCH---HHHHHHHHHHHHHHCCCCSGGG---S-SCCHHHHHHHHHHH---TSSCHHHHHHHHHHHHHHCSSHHHHHHSCH80 (115)
Q ss_pred81HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC115 (115)
Q HAMP_TM_310_2381QGLERQRLETEQVAAAVNQMAATTQEVASHVQRTA115 (115)
T 1KG4_A81DEVLHLWTGLGYY-ARARNLHKAAQQVATLHGGKF115 (115)
T ss_pred81HHHHHHHHCCCCH-HHHHHHHHHHHHHHHHHCCCC115 (115)
T ss_dssp81HHHHHHHTTSCCT-HHHHHHHHHHHHHHHHSTTSC115 (115)