TreeThreader - Results

  Job information

Job ID: HAMP_TM_310
#Proteins: 96
Protein ID: HAMP_TM_310_19
Fasta ID: |WP_003087330.1|/189-303
Submission time: 2018-07-18 22:44:38 +0800
Finished time: 2019-02-17 12:50:15 +0800
Identical Job(s): HAMP_TM_310_16 HAMP_TM_310_18 HAMP_TM_310_20

  Alignments

1
50
100
115

  Build multi-template model (choose up to 5 templates)

Building multi-template model...

  Top 10 hits

Query:
Job ID  : HAMP_TM_310_19
Length : 115
Sequence: AGLRWQKRGLKRLMRLAEQTTSDPLIAQMYTDSRGDQARLEMAILSQDARLKTCLTRLQDTAEYLTEQARQADTLAHHSS AGLEQQRAETEQVATAVNEMAATTQEVANNVQLTA

No Hit MAC Score Identity Cols Query HMM Template HMM

  Pairwise Query-Template Alignment