TreeThreader - Results

  Job information

Job ID: d20180708
#Proteins: 4
Protein ID: d20180708_4
Fasta ID: seq4
Submission time: 2018-07-08 10:54:02 +0800
Finished time: 2019-02-17 15:12:57 +0800
Identical Job(s): NULL

  Alignments

1
50
100
150
200
250
299
1IZC_A 1IZC_A 1DXF_A 1DXF_A 2V5K_A 2V5K_A 2VWS_A 2VWS_A 3QQW_F 3QQW_F 2XZ7_A 2XZ7_A 2L5H_A 2L5H_A 2HRO_A 2HRO_A 2BG5_B 2BG5_B 3R4I_A 3R4I_A

  Build multi-template model (choose up to 5 templates)

                   
Download full-length structure

  Top 10 hits

Query:
Job ID  : d20180708_4
Length : 299
Sequence: AKSYSLQPELHNKCPVRLAMLTYPGNLRQNHKDAMADKSKTLMGAAHGTPSTDVTSWMAAMKPRFVWIDVAHGCFNRPEL HDRIHAAKHGSEGSSLVIVPTPTHWFFPWYTAADAGCPKIVIPHVETVEEVLEFVLECYYGPIGRNEFSPWTFSPGIADA QLDPNVWYNVATSNAHVCIIDRIESTKLVENCGMSASMPENHGLMFQPGDYMIDETLWLLRILSGVPHWTFVEAMTKFST AAQRNGVPEFGHALSVDTVPSPSFQGGRAHACQEDVWGLSRLWHGSLAQARASAPQFWG

No Hit MAC Score Identity Cols Query HMM Template HMM
11IZC_A187.870.742991-2992-300
21DXF_A143.080.212566-2961-256
32V5K_A142.980.152681-29912-279
42VWS_A141.330.1525919-2991-259
53QQW_F89.390.122451-2999-283
62XZ7_A89.160.12501-2991-306
72L5H_A88.960.092761-299141-557
82HRO_A87.780.12931-299161-558
92BG5_B82.30.082705-2991-305
103R4I_A81.660.12515-2991-295

  Pairwise Query-Template Alignment

No 1
> 1IZC_A    Macrophomate synthase intermolecular diels-aldera; TIM-barrel, pyruvate Mg(II) complex, lyase; 1.70A {Macrophoma commelinae} SCOP: c.1.12.5     Alignment in PIR format
MAC score = 187.87	Identity = 0.74

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHCCCCEEEEECCCCCCCHHHH80 (299)
Q d20180708_41AKSYSLQPELHNKCPVRLAMLTYPGNLRQNHKDAMADKSKTLMGAAHGTPSTDVTSWMAAMKPRFVWIDVAHGCFNRPEL80 (299)
T 1IZC_A1AKSYSEQPELHAKAPYRSAMLTYPGNLRQALKDAMADPSKTLMGVAHGIPSTFVTKVLAATKPDFVWIDVEHGMFNRLEL80 (299)
T ss_pred1CCCCCCCHHHHHCCCHHCCCCCCCCCHHHHHHHHHHCCCCEEEEEEEECCCHHHHHHHHCCCCCEEEECCCCCCCCHHHH80 (299)
T ss_dssp1CCSGGGCGGGSCCCTTCCSSTTSCCCHHHHHHHHHHCGGGCEEEEEECSCCHHHHHHHHHTCCSEEEEETTTSCCCHHHH80 (299)
Q ss_pred81HHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCC160 (299)
Q d20180708_481HDRIHAAKHGSEGSSLVIVPTPTHWFFPWYTAADAGCPKIVIPHVETVEEVLEFVLECYYGPIGRNEFSPWTFSPGIADA160 (299)
T 1IZC_A81HDAIHAAQHHSEGRSLVIVRVPKHDEVSLSTALDAGAAGIVIPHVETVEEVREFVKEMYYGPIGRRSFSPWTFSPGIADA160 (299)
T ss_pred81HHHHHHHHHCCCCCCEEEEEECCCCHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHH160 (299)
T ss_dssp81HHHHHHHHHHTTTCSEEEEECCTTCHHHHHHHHHHTCSEEEETTCCCHHHHHHHHHHHSCTTTCCCCCCSTTCBTTTBCC160 (299)
Q ss_pred161CCCCCCCHHCCCCCCCEEEEEEECCHHHHHHHHHHHCCCCCCEEEECCCCCCCCCHHHHHHHHCCCCCHHHHHHHHHHHH240 (299)
Q d20180708_4161QLDPNVWYNVATSNAHVCIIDRIESTKLVENCGMSASMPENHGLMFQPGDYMIDETLWLLRILSGVPHWTFVEAMTKFST240 (299)
T 1IZC_A161SLFPNDPYNVATSNNHVCIIPQIESVKGVENVDAIAAMPEIHGLMFGPGDYMIDAGLDLNGALSGVPHPTFVEAMTKFST240 (299)
T ss_pred161HCCCCHHHHHHHCCCCCEEEEEECHHHHHHHHHHHHCCCCCEEEEECHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHH240 (299)
T ss_dssp161CSSTTCTTCHHHHHHHCEEEEEECSHHHHHTHHHHHTCTTCCCEEECHHHHHHHTTCCTTCCTTSCCCHHHHHHHHHHHH240 (299)
Q ss_pred241HHHHCCCCCEECCCCCCCCCCCCCCCCCEEEEEEHHHHHHHHHHHHHHHHHHHCCCCCC299 (299)
Q d20180708_4241AAQRNGVPEFGHALSVDTVPSPSFQGGRAHACQEDVWGLSRLWHGSLAQARASAPQFWG299 (299)
T 1IZC_A241AAQRNGVPIFGGALSVDMVPSLIEQGYRAIAVQFDVWGLSRLVHGSLAQARASAKQFAG299 (299)
T ss_pred241HHHHHCCEEEEEECCHHHHHHHHHHCCCEEEECCHHHHHHHHHHHHHHHHHHHHHHHHH299 (299)
T ss_dssp241HHHHTTCCEEEECSSGGGHHHHHHTTEEEEEEEEHHHHHHHHHHHHHHHHHHHHGGGCC299 (299)


No 2
> 1DXF_A        Alignment in PIR format
MAC score = 143.08	Identity = 0.21

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHH80 (291)
Q d20180708_41LQPELHNKCPVRLAMLTYPGNLRQNHKDAMADKSKTLMGAAHGTPSTDVTSWMAAMKPRFVWIDVAHGCFNRPELHDRIH80 (291)
T 1DXF_A1MNN------------DVFPN----KFKAALAAKQ-VQIGCWSALSNPISTEVLGLAGFDWLVLDGEHAPNDISTFIPQLM80 (291)
T ss_pred1CCC------------CCCCC----HHHHHHHCCC-EEEEEEECCCCHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHH80 (291)
T ss_dssp1UUU------------CCCSC----HHHHHHHTTC-CEEEEEECSCCHHHHHHHTTSCCSEEEEESSSSSCCHHHHHHHHH80 (291)
Q ss_pred81HHHHCCCCCEEEEEECCCCCCHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCC160 (291)
Q d20180708_481AAKHGSEGSSLVIVPTPTHWFFPWYTAADAGCPKIVIPHVETVEEVLEFVLECYYGPIGRNEFSPWTFSPGIADAQLDPN160 (291)
T 1DXF_A81ALKG---SASAPVVRVPTNEPVIIKRLLDIGFYNFLIPFVETKEEAELAVASTRYPPEGIRGVSVSHRANM-F-----GT160 (291)
T ss_pred81HHHH---CCCCEEEECCCCCHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCCHHHHCCC-C-----CC160 (291)
T ss_dssp81HTTT---CSSEEEEECSSSCHHHHHHHHHTTCCEEEESCCCSHHHHHHHHHHTSCTTSCCCCCCSSSTTTG-G-----GT160 (291)
Q ss_pred161CCHHCCCCCCCEEEEEEECCHHHHHHHHHHHCCCCCCEEEECCCCCCCCCHHHHHHHHCCCCCHHHHHHHHHHHHHHHHC240 (291)
Q d20180708_4161VWYNVATSNAHVCIIDRIESTKLVENCGMSASMPENHGLMFQPGDYMIDETLWLLRILSGVPHWTFVEAMTKFSTAAQRN240 (291)
T 1DXF_A161VADYFAQSNKNITILVQIESQQGVDNVDAIAATEGVDGIFVGPSDLAAALG-----HLGNASHPDVQKAIQHIFNRASAH240 (291)
T ss_pred161HHHHHHHCCCCCEEEEEECCHHHHHHHHHHHCCCCCCEEEECCHHHHHHHC-----CCCCCCCHHHHHHHHHHHHHHHHC240 (291)
T ss_dssp161STTHHHHHTTSCEEEEEECSHHHHHTHHHHHHSTTEEEEEECHHHHHHHTT-----CTTCTTSHHHHHHHHHHHHHHHHT240 (291)
Q ss_pred241CCCCEECCCCCCCCCCCCCCCCCEEEEEEHHHHHHHHHHHHHHHHHHHCCC291 (291)
Q d20180708_4241GVPEFGHALSVDTVPSPSFQGGRAHACQEDVWGLSRLWHGSLAQARASAPQ291 (291)
T 1DXF_A241GKPSGILAPVEADARRYLEWGA-TFVAVGSDLGVFR--SATQKLADTF-KK291 (291)
T ss_pred241CCCEEEECCCHHHHHHHHHCCC-CEEEEEHHHHHHH--HHHHHHHHHH-CC291 (291)
T ss_dssp241TCCEEEECCSHHHHHHHHHTTC-CEEEEEEHHHHHH--HHHHHHHHHH-HC291 (291)


No 3
> 2V5K_A        Alignment in PIR format
MAC score = 142.98	Identity = 0.15

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHCCCCEEEEECCCCCCCHHHH80 (299)
Q d20180708_41AKSYSLQPELHNKCPVRLAMLTYPGNLRQNHKDAMADKSKTLMGAAHGTPSTDVTSWMAAMKPRFVWIDVAHGCFNRPEL80 (299)
T 2V5K_A1VDIPTTENLYFQ--------GAMEN----SFKAALKA-GRPQIGLWLGLSSSYSAELLAGAGFDWLLIDGEHAPNNVQTV80 (299)
T ss_pred1CCCCCCCCCCCC--------CCCCC----HHHHHHHC-CCEEEEEEECCCCHHHHHHHHHCCCCEEEEECCCCCCCHHHH80 (299)
T ss_dssp1UUUUUCHHHHHT--------TSSCC----HHHHHHHT-TCCEEEEEECSCCHHHHHHHHTSCCSEEEEESSSSSCCHHHH80 (299)
Q ss_pred81HHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCC160 (299)
Q d20180708_481HDRIHAAKHGSEGSSLVIVPTPTHWFFPWYTAADAGCPKIVIPHVETVEEVLEFVLECYYGPIGRNEFSPWTFSPGIADA160 (299)
T 2V5K_A81LTQLQAIAP---YPSQPVVRPSWNDPVQIKQLLDVGTQTLLVPMVQNADEAREAVRATRYPPAGIRGVGSALAR-ASRW-160 (299)
T ss_pred81HHHHHHHHH---CCCCEEEECCCCCHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCC-CCCC-160 (299)
T ss_dssp81HHHHHHHTT---SSSEEEEECSSSCHHHHHHHHHTTCCEEEESCCCSHHHHHHHHHHTSCTTSCCCCCCTTSCG-GGTT-160 (299)
Q ss_pred161CCCCCCCHHCCCCCCCEEEEEEECCHHHHHHHHHHHCCCCCCEEEECCCCCCCCCHHHHHHHHCCCCCHHHHHHHHHHHH240 (299)
Q d20180708_4161QLDPNVWYNVATSNAHVCIIDRIESTKLVENCGMSASMPENHGLMFQPGDYMIDETLWLLRILSGVPHWTFVEAMTKFST240 (299)
T 2V5K_A161---NRIPDYLQKANDQMCVLVQIETREAMKNLPQILDVEGVDGVFIGPADLSADM-----GYAGNPQHPEVQAAIEQAIV240 (299)
T ss_pred161---CCHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHCCCCCCEEEECCHHHHHHH-----CCCCCCCCHHHHHHHHHHHH240 (299)
T ss_dssp161---TTSTTHHHHTGGGCEEEEEECSHHHHHTHHHHHTSTTEEEEEECHHHHHHHH-----TSTTCCCSHHHHHHHHHHHH240 (299)
Q ss_pred241HHHHCCCCCEECCCCCCCCCCCCCCCCCEEEEEEHHHHHHHHHHHHHHHHHHHCCCCCC299 (299)
Q d20180708_4241AAQRNGVPEFGHALSVDTVPSPSFQGGRAHACQEDVWGLSRLWHGSLAQARASAPQFWG299 (299)
T 2V5K_A241QIRESGKAPGIL-IANEQLAKRYLELGALFVAVGVDTT--LLARA--AEALAARFGAQA299 (299)
T ss_pred241HHHHCCCCEEEE-CCCHHHHHHHHHCCCCEEEEECCHH--HHHHH--HHHHHHHHHHCC299 (299)
T ss_dssp241HHHHTTCEEEEE-CSCHHHHHHHHHTTCSEEEEEEHHH--HHHHH--HHHHHHHTCUUU299 (299)


No 4
> 2VWS_A    YFAU, 2-keto-3-deoxy sugar aldolase; lyase, escherichia coli K-12 protein YFAU, 2-keto-3-deoxy SU aldolase, degradation of homoprotocatechuate; 1.39A {Escherichia coli} SCOP: c.1.12.0 PDB: 2vwt_A     Alignment in PIR format
MAC score = 141.33	Identity = 0.15

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCCEEEE80 (281)
Q d20180708_41AMLTYPGNLRQNHKDAMADKSKTLMGAAHGTPSTDVTSWMAAMKPRFVWIDVAHGCFNRPELHDRIHAAKHGSEGSSLVI80 (281)
T 2VWS_A1MNALLSN----PFKERLRK-GEVQIGLWLSSTTAYMAEIAATSGYDWLLIDGEHAPNTIQDLYHQLQAVAP---YASQPV80 (281)
T ss_pred1CCCCCHH----HHHHHHHC-CCCEEEEEEECCCHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHH---CCCCEE80 (281)
T ss_dssp1CCCSCCC----HHHHHHHT-TCCEEEEEECSCCHHHHHHHHTTCCSEEEEETTTSCCCHHHHHHHHHHHTT---SSSEEE80 (281)
Q ss_pred81EECCCCCCHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHCCCCCCCEE160 (281)
Q d20180708_481VPTPTHWFFPWYTAADAGCPKIVIPHVETVEEVLEFVLECYYGPIGRNEFSPWTFSPGIADAQLDPNVWYNVATSNAHVC160 (281)
T 2VWS_A81IRPVEGSKPLIKQVLDIGAQTLLIPMVDTAEQARQVVSATRYPPYGERGVGASVAR-AARW----GRIENYMAQVNDSLC160 (281)
T ss_pred81EECCCCCHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCH-HHCC----CCHHHHHHHCCCCCE160 (281)
T ss_dssp81EECSSCCHHHHHHHHHTTCCEEEECCCCSHHHHHHHHHHTSCTTTSCCCSCGGGSG-GGGG----GTSTTHHHHHHHHCE160 (281)
Q ss_pred161EEEEECCHHHHHHHHHHHCCCCCCEEEECCCCCCCCCHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCEECCCCCCC240 (281)
Q d20180708_4161IIDRIESTKLVENCGMSASMPENHGLMFQPGDYMIDETLWLLRILSGVPHWTFVEAMTKFSTAAQRNGVPEFGHALSVDT240 (281)
T 2VWS_A161LLVQVESKTALDNLDEILDVEGIDGVFIGPADLSASLG-----YPDNAGHPEVQRIIETSIRRIRAAGKAAGFLAVAPDM240 (281)
T ss_pred161EEEEECCHHHHHHHHHHHCCCCCCEEEECCHHHHHHCC-----CCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHH240 (281)
T ss_dssp161EEEECCSHHHHHTHHHHHTSTTCCEEEECHHHHHHHTT-----CSSSCCTHHHHHHHHHHHHHHHHTTCEEEEECSSHHH240 (281)
Q ss_pred241CCCCCCCCCCEEEEEEHHHHHHHHHHHHHHHHHHHCCCCCC281 (281)
Q d20180708_4241VPSPSFQGGRAHACQEDVWGLSRLWHGSLAQARASAPQFWG281 (281)
T 2VWS_A241AQQCLAWGANFVAVGVD----TMLYSDALDQRLAMFKSGKN281 (281)
T ss_pred241HHHHHHCCCCEEEECHH----HHHHHHHHHHHHHHHHCCCC281 (281)
T ss_dssp241HHHHHHTTCCEEEEEEH----HHHHHHHHHHHHHTTCCUUU281 (281)


No 5
> 3QQW_F        Alignment in PIR format
MAC score = 89.39	Identity = 0.12

Download partial structureDownload full-length structure
Q ss_pred1CCC-CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHC----CCCEEEEECCCCCC80 (329)
Q d20180708_41AKS-YSLQPELHNKCPVRLAMLTYPGNLRQNHKDAMADKSKTLMGAAHGTPSTDVTSWMAAM----KPRFVWIDVAHGCF80 (329)
T 3QQW_F1NDALFAGEKSFP---------------------------VLAACEHFAG-SEKLIGKAMDLQVEYGPVFDVTCDCEDGAA80 (329)
T ss_pred1HHHHHCCCCCCC---------------------------CCCCEEECCC-CHHHHHHHHHCCCCCCCCCEEEEECCCCCC80 (329)
T ss_dssp1UUUUUUUUUCCC---------------------------CCCSEEEEEC-SHHHHHHHHHHHHHHCSSEEEEEESTTTSC80 (329)
Q ss_pred81--CHHHHHHHHHHHHHCCCC-CEEEEEECCCCCC----HH---HHHHHCCCCCEEEEECCCCHHHHHHHHHHCCCCCCCC160 (329)
Q d20180708_481--NRPELHDRIHAAKHGSEG-SSLVIVPTPTHWF----FP---WYTAADAGCPKIVIPHVETVEEVLEFVLECYYGPIGR160 (329)
T 3QQW_F81AGQEREHAEMVARMIASDRNVHGRAGARIHDPSHPAWRQDVDIIVNGAGGRLAYITVPKATNSGQVAEVIRYIGDVA---160 (329)
T ss_pred81CCCHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHH---160 (329)
T ss_dssp81TTCHHHHHHHHHHHHHSTTCCSSCEEEECCCTTSTTHHHHHHHHHHHSTTCCCCEEECCCCSHHHHHHHHHHHHHHH---160 (329)
Q ss_pred161CCCCCCCCCCCCCCCCCCCCCCHHCCCCCCCEEEEEEECCHHHHHHHHHHHCCCCCCEEEECCCCCCCCCHHHHHHHHC-240 (329)
Q d20180708_4161NEFSPWTFSPGIADAQLDPNVWYNVATSNAHVCIIDRIESTKLVENCGMSASMPENHGLMFQPGDYMIDETLWLLRILS-240 (329)
T 3QQW_F161----------------------KRAGL-DKPVPVHVLIETHGALRDVFQIAELPNIEVLDFGLMDFVSGHHGAIPAAAMR240 (329)
T ss_pred161----------------------HHCCC-CCCCEEEEEECCHHHHHHHHHHHHCCCCCEEEECHHHHHHHCCCCCCCCCCC240 (329)
T ss_dssp161----------------------HHTTC-SSCCCEEEEECSHHHHHTHHHHTTSTTEEEEEECHHHHHHTTTTCSCGGGGS240 (329)
Q ss_pred241---CCCCHHHHHHHHHHHHHHHHCCCCCEECCCCC-CCCC---CC---C--CCCCCEEEEEEHHH--HHHHHHHHHHHHH320 (329)
Q d20180708_4241---GVPHWTFVEAMTKFSTAAQRNGVPEFGHALSV-DTVP---SP---S--FQGGRAHACQEDVW--GLSRLWHGSLAQA320 (329)
T 3QQW_F241SPGQFEHALLVRAKADMVAAALANGIVPAHNVCLNLKDAEVIASDACRARNEFGFLRMWSIYPAQIQPIVNAMRPDFTEV320 (329)
T ss_pred241CCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEECCHHHHHHHHHHCCCCHHHH320 (329)
T ss_dssp241TTGGGTSHHHHHHHHHHHHHHHTTTCEEEECCCSCSSCHHHHHHHHHHHHHHHCCCEEEESSGGGHHHHHHHHSCCHHHH320 (329)
Q ss_pred321HHHCCCCCC329 (329)
Q d20180708_4321RASAPQFWG329 (329)
T 3QQW_F321EDAAGILVA329 (329)
T ss_pred321HHHHHHHHH329 (329)
T ss_dssp321HHHHHCUUU329 (329)


No 6
> 2XZ7_A        Alignment in PIR format
MAC score = 89.16	Identity = 0.1

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHCCCC-EEEEECCCCC-----80 (355)
Q d20180708_41AKSYSLQPELHNKCPVRLAMLTYPGNLRQNHKDAMADKSKTLMGAAHGTPSTDVTSWMAAMKPR-FVWIDVAHGC-----80 (355)
T 2XZ7_A1HM-EG--LKQLKD-------------------LPAETPDGKKVMLAANIGTPKDVASALANGAEGVGLFRTEFLYMDRNS80 (355)
T ss_pred1CH-HH--HHHHHC-------------------CCCCCCCCCEEEEEECCCCHHHHHHHHHCCCCEEEEHHHHHHHCCCCC80 (355)
T ss_dssp1CC-CC--HHHHTT-------------------SCCBCTTSCBCEEEEEESSGGGHHHHHHTTCSSEEEEECGGGTSSCSS80 (355)
Q ss_pred81-CCHHHHHHHHHHHHHCCCCCEEEEEECCC--CCCH---------------------------------HHHHHHCCCCC160 (355)
Q d20180708_481-FNRPELHDRIHAAKHGSEGSSLVIVPTPT--HWFF---------------------------------PWYTAADAGCP160 (355)
T 2XZ7_A81LPSEEEQFEAYKEVVEKMGGRPVTIRTLDIGGDKELPYLDMPKEMNPFLGYRAIRLCLDRPDIFKTQLRAILRASAYGNV160 (355)
T ss_pred81CCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHHHHHHHCCCCC160 (355)
T ss_dssp81CCCHHHHHHHHHHHHHHTTTSCEEEECCCCCTTSCCTTTCCCCCSCGGGSSCTHHHHHHCHHHHHHHHHHHHHHGGGSCE160 (355)
Q ss_pred161EEEEECCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHCC----CCCCCEEEEEEECCHHHHHHHHH240 (355)
Q d20180708_4161KIVIPHVETVEEVLEFVLECYYGPIGRNEFSPWTFSPGIADAQLDPNVWYNVA----TSNAHVCIIDRIESTKLVENCGM240 (355)
T 2XZ7_A161QIMYPMISSVEEVRKANSILEE-------------------------VKAELDREGVKYDKEIKVGIMVEIPSAAVTADI240 (355)
T ss_pred161EEEECCCCCHHHHHHHHHHHHH-------------------------HHHHHHHHCCCCCCCCEEEEEEHHHHHHHHHHH240 (355)
T ss_dssp161EEEESSCCCHHHHHHHHHHHHH-------------------------HHHHHHHHTCCCCTTCEEEEEECSHHHHHTHHH240 (355)
Q ss_pred241HHCCCCCCEEEECCCCCCC-----CCHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCEECCCCCCCC---CCCCCCC320 (355)
Q d20180708_4241SASMPENHGLMFQPGDYMI-----DETLWLLRILSGVPHWTFVEAMTKFSTAAQRNGVPEFGHALSVDTV---PSPSFQG320 (355)
T 2XZ7_A241LAKE--VDFFSIGTNDLTQYTLAVDRMNEHVKEYYQPFHPAILRLVKMVIDAAHKEGKFAAMCGEMAGDPLAAVILLGLG320 (355)
T ss_pred241HHHH--CCEEEECHHHHHHHHHHHCCCCCHHHHHCCCCCHHHHHHHHHHHHHHHHCCCEEEECCCCCCCHHHHHHHHHCC320 (355)
T ss_dssp241HHTT--CSEEEECHHHHHHHHHTCCTTCGGGGGGCCTTCHHHHHHHHHHHHHHHHTTCEEEECSGGGGCHHHHHHHHHHT320 (355)
Q ss_pred321CCEEEEEEHHHHHH--HHHHHHHHHHHHHCCCCCC355 (355)
Q d20180708_4321GRAHACQEDVWGLS--RLWHGSLAQARASAPQFWG355 (355)
T 2XZ7_A321LDEFSMSATSIPEIKNIIRNVEYEKAKEIAEKALN355 (355)
T ss_pred321CCEEEECHHHHHHHHHHHHHCCHHHHHHHHHHHHC355 (355)
T ss_dssp321CCEEEECGGGHHHHHHHHHTSCHHHHHHHHHHHHT355 (355)


No 7
> 2L5H_A        Alignment in PIR format
MAC score = 88.96	Identity = 0.09

Download partial structureDownload full-length structure
Q ss_pred1CCCCCC-----C-CCC---CCCCC-----------------------------------------------------CCC80 (440)
Q d20180708_41AKSYSL-----Q-PEL---HNKCP-----------------------------------------------------VRL80 (440)
T 2L5H_A1ILGLKIIDLSAIQDEVILVAADLTPSETAQLNLKKVLGFITDAGGRTSQTSIMARSLELPAIVGTGSVTSQVKNDDYLIL80 (440)
T ss_pred1HCCCCCCHHCCCCCCEEEEECCCCHHHHHHCCHHHCEEEEECCCCCCHHHHHHHHHCCCCEEEECHHHHHHCCCCCEEEE80 (440)
T ss_dssp1HHTCCCCCTTCCCSCEEEEESCCCHHHHHTCCTTTEEEEEECSSSTTSHHHHHHHHHTCCEESCCSSSTTTCCTTEEEEE80 (440)
Q ss_pred81CC---CCCC---CCHHHHH----HHHHH---CC-----------CCCCEEEECCCCCHHHHHHHHHCCCCEEEEECCCC-160 (440)
Q d20180708_481AM---LTYP---GNLRQNH----KDAMA---DK-----------SKTLMGAAHGTPSTDVTSWMAAMKPRFVWIDVAHG-160 (440)
T 2L5H_A81DAVNNQVYVNPTNEVIDKMRAVQEQVASEKAELAKLKDLPAITLDGHQVEVCANIGTVRDVEGAERNGAEGVGLYRTEFL160 (440)
T ss_pred81ECCCCEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEECCCHHHHHHHHHCCCCEEEHHHHHHH160 (440)
T ss_dssp81CSSSSCEEESCCHHHHHHHHHHHHHHHHHHHHHTSCCCCSSBCTTSCBCEEEEEESSTHHHHHHHHHTCSSEEEEEHHHH160 (440)
Q ss_pred161------CCCHHHHHHHHHHHHHCCCCCEEEEEECCC--CCCHHH---------------------------------HHH240 (440)
Q d20180708_4161------CFNRPELHDRIHAAKHGSEGSSLVIVPTPT--HWFFPW---------------------------------YTA240 (440)
T 2L5H_A161FMDRDALPTEEEQFAAYKAVAEACGSQAVIVRTMDIGGDKELPYMNFPKEENPFLGWRAIRIAMDRREILRDQLRAILRA240 (440)
T ss_pred161HHCCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHHHHHH240 (440)
T ss_dssp161HTTSSSCCCHHHHHHHHHHHHHHTTTCCEEEECCCCSSSCCCGGGCCCCCSCGGGSSCTHHHHTTCHHHHHHHHHHHHHH240 (440)
Q ss_pred241HCCCCCEEEEECCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHCCCCCCCEEEEEEECCHHHHHHH320 (440)
Q d20180708_4241ADAGCPKIVIPHVETVEEVLEFVLECYYGPIGRNEFSPWTFSPGIADAQLDPNVWYNVATSNAHVCIIDRIESTKLVENC320 (440)
T 2L5H_A241SAFGKLRIMFPMIISVEEVRALRKEIEIYKQ---------------------ELRDEGKAFDESIEIGVMVETPAAATIA320 (440)
T ss_pred241HCCCCEEEEECCCCCHHHHHHHHHHHHHHHH---------------------HHHHHCCCCCCCCEEEEEEHHHHHHHHH320 (440)
T ss_dssp241TTSSCEEEEESSCCCHHHHHHHHHHHHHHHH---------------------HHHHTTCCCCTTCEEEEEECSHHHHHTH320 (440)
Q ss_pred321HHHHCCCCCCEEEECCCCCC-----CCCHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCEECC---CCCCCCCCCCC400 (440)
Q d20180708_4321GMSASMPENHGLMFQPGDYM-----IDETLWLLRILSGVPHWTFVEAMTKFSTAAQRNGVPEFGHA---LSVDTVPSPSF400 (440)
T 2L5H_A321RHLAKE--VDFFSIGTNDLTQYTLAVDRGNDMISHLYQPMSPSVLNLIKQVIDASHAEGKWTGMCGELAGDERATLLLLG400 (440)
T ss_pred321HHHHHH--CCEEEECHHHHHHHHHHHCCCCHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCEEEECCCCCCCHHHHHHHHH400 (440)
T ss_dssp321HHHHTT--CSEEEECHHHHHHHHHTCCTTCGGGGGGCCSSSHHHHHHHHHHHHHHHHTTCEEEECSGGGGCTTTHHHHHH400 (440)
Q ss_pred401CCCCEEEEEEHHHH-HHHHHHHH----HHHHHHHCCCCCC440 (440)
Q d20180708_4401QGGRAHACQEDVWG-LSRLWHGS----LAQARASAPQFWG440 (440)
T 2L5H_A401MGLDEFSMSAISIPRIKKIIRNTNFEDAKVLAEQALAQPT440 (440)
T ss_pred401CCCCEEEECHHHHHHHHHHHHHCCHHHHHHHHHHHHCCCC440 (440)
T ss_dssp401TTCCEEEECGGGHHHHHHHHHTSCHHHHHHHHHHHHHCSS440 (440)


No 8
> 2HRO_A        Alignment in PIR format
MAC score = 87.78	Identity = 0.1

Download partial structureDownload full-length structure
Q ss_pred1CCCC-CCCCC-CCCC----------------------CCCC--------------------------------------C80 (404)
Q d20180708_41AKSY-SLQPE-LHNK----------------------CPVR--------------------------------------L80 (404)
T 2HRO_A1GNDLTPSDTAQLNKEYVQGFVTNIGGRTSHSAIMSRSLEIPAVVGTKSITEEVEAGDTIVVDGMTGDVLINPSDEVIAEY80 (404)
T ss_pred1ECCCCHHHHHCCCHHHHHHHEECCCCCHHHHHHHHHHCCCCEEEECCHHHHHCCCCCEEEEECCCCEEEECCCHHHHHHH80 (404)
T ss_dssp1CSSCCTTTTTSSCTTTCCSCBCCCCUUUCHHHHHHHHTTCBCCUCCSSGGGSSCSCCUCCCCUUUUCCCUUCCSSTTTHH80 (404)
Q ss_pred81CCCCCCCCHHHHHHHHHHCC-----CCCCEEEECCCCCHHHHHHHHHCCCCEEE-EECCCC------CCCHHHHHHHHHH160 (404)
Q d20180708_481AMLTYPGNLRQNHKDAMADK-----SKTLMGAAHGTPSTDVTSWMAAMKPRFVW-IDVAHG------CFNRPELHDRIHA160 (404)
T 2HRO_A81QEKRENFFKDKQELQKLRDAESVTADGHHVELAANIGTPNDLPGVIENGAEGIGLYRTEFLYMGRDQMPTEEEQFEAYKA160 (404)
T ss_pred81HHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCHHHHHHHHHCCCCEEEHHHHHHHHCCCCCCCCHHHHHHHHHH160 (404)
T ss_dssp81HHHHTTHHHHHHHHHGGGSSCCBCTTSCBCEEEEEESSGGGHHHHHTTTCSSEEEEECGGGTSSCSSCCCHHHHHHHHHH160 (404)
Q ss_pred161HHHCCCCCEEEEEECC-C-CCCHHHHHHHCCC----CCEEEEECCCCHHHHHHHHHHCCCC-CCCCCCCCCCCCCCCCCC240 (404)
Q d20180708_4161AKHGSEGSSLVIVPTP-T-HWFFPWYTAADAG----CPKIVIPHVETVEEVLEFVLECYYG-PIGRNEFSPWTFSPGIAD240 (404)
T 2HRO_A161VLEAMKGKRVVVRTLDIGGDKELPYLDLPEEMNPFLGYRAIRLCLDQPEIFRPQLRALLRASVFGK----LNIMFPMVAT240 (404)
T ss_pred161HHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHHHHHHHCCCC----CEEEECCCCC240 (404)
T ss_dssp161HHHHTTTCEEEEECCCCBTTSCCSSSCCCCCSSGGGSSBTHHHHHHCHHHHHHHHHHHHHHGGGSE----EEEEESSCCS240 (404)
Q ss_pred241CCCCC-------CCCHHCC----CCCCCEEEEEEECCHHHHHHHHHHHCCCCCCEEEECCCCCCC-----CCHHHHHHHH320 (404)
Q d20180708_4241AQLDP-------NVWYNVA----TSNAHVCIIDRIESTKLVENCGMSASMPENHGLMFQPGDYMI-----DETLWLLRIL320 (404)
T 2HRO_A241IQEFRDAKALLEEERANLKNEGYEVADDIELGIMVEIPSTAALADIFAKE--VDFFSIGTNDLIQYTMAADRMSERVSYL320 (404)
T ss_pred241HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEHHHHHHHHHHHHHHH--CCEEEECCCHHHHHHHHHCCCCHHHHHH320 (404)
T ss_dssp241HHHHHHHHHHHHHHHHHHHTTTCCCCSCCEEEEEECSHHHHHTHHHHHHH--CSEEEECHHHHHHHHHTCCTTCSTTGGG320 (404)
Q ss_pred321CCCCCHHHHHHHHHHHHHHHHCCCCCEECC--CCCCC-CCCCCCCCCCEEEEEEHH-HHHHHHHHH-HHHHHHH---HCC400 (404)
Q d20180708_4321SGVPHWTFVEAMTKFSTAAQRNGVPEFGHA--LSVDT-VPSPSFQGGRAHACQEDV-WGLSRLWHG-SLAQARA---SAP400 (404)
T 2HRO_A321YQPYNPAILRLVKQVIEASHAEGKWTGMCGEMAGDQTAIPLLLGLGLDEFSMSATSILKARRLIRSLNESEMKELSERAV400 (404)
T ss_pred321HCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECHHHHHHHHHHHHHCCHHHHHHHHHHHH400 (404)
T ss_dssp321CCTTSHHHHHHHHHHHHHHHHTTCEEEECSGGGGCTTTHHHHHHHTCSEEEECGGGHHHHHHHHHTCCHHHHHHHHHHHT400 (404)
Q ss_pred401CCCC404 (404)
Q d20180708_4401QFWG404 (404)
T 2HRO_A401QCAT404 (404)
T ss_pred401HCCC404 (404)
T ss_dssp401TCSS404 (404)


No 9
> 2BG5_B        Alignment in PIR format
MAC score = 82.3	Identity = 0.08

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHCCCC-EEEEECCCCC------CCH80 (330)
Q d20180708_41SLQPELHNKCPVRLAMLTYPGNLRQNHKDAMADKSKTLMGAAHGTPSTDVTSWMAAMKPR-FVWIDVAHGC------FNR80 (330)
T 2BG5_B1MEGLKQLKDLP-------------------AETPDGKKVMLAANIGTPKDVASALANGAEGVGLFRTEFLYMDRNSLPSE80 (330)
T ss_pred1CCHHHHHHCCC-------------------CCCCCCEEEEEEECCCCHHHHHHHHHCCCCEEEHHHHHHHHCCCCCCCCH80 (330)
T ss_dssp1UCCHHHHTTSC-------------------EECTTSCEEEEEEEESSGGGHHHHHHTTCSSEEEEECGGGTSSSSSCCCH80 (330)
Q ss_pred81HHHHHHHHHHHHCCCCCEEEEEEC-CC-CCCHHHHHHHCCC---CCEE-EEECCCCHHHHHHHHHHCCCC-CCCCCCCCC160 (330)
Q d20180708_481PELHDRIHAAKHGSEGSSLVIVPT-PT-HWFFPWYTAADAG---CPKI-VIPHVETVEEVLEFVLECYYG-PIGRNEFSP160 (330)
T 2BG5_B81EEQFEAYKEVVEKMGGRPVTIRTLDIGGDKELPYLDMPKEMNPFLGYRAIRLCLDRPDIFKTQLRAILRASAYG--N--V160 (330)
T ss_pred81HHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHHHHHHHCCC--C--C160 (330)
T ss_dssp81HHHHHHHHHHHHHTTTSCEEEECCCCBTTSCCGGGTCCCCSCGGGSSBTHHHHHHCHHHHHHHHHHHHHHGGGS--C--E160 (330)
Q ss_pred161CCCCCCCCCCCCC-------CCCCHHC----CCCCCCEEEEEEECCHHHHHHHHHHHCCCCCCEEEECCCCCCC-----C240 (330)
Q d20180708_4161WTFSPGIADAQLD-------PNVWYNV----ATSNAHVCIIDRIESTKLVENCGMSASMPENHGLMFQPGDYMI-----D240 (330)
T 2BG5_B161QIMYPMISSVEEVRKANSILEEVKAELDREGVKYDKEIKVGIMVEIPSAAVTADILAKE--VDFFSIGTNDLTQYTLAVD240 (330)
T ss_pred161EEEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEHHHHHHHHHHHHHHH--CCEEEECCCHHHHHHHHHC240 (330)
T ss_dssp161EEEECSCCCHHHHHHHHHHHHHHHHHHHHHTCCCCTTCEEEEEECSHHHHHTHHHHHTT--CSEEEECHHHHHHHHHTCC240 (330)
Q ss_pred241CHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCEECCCCCCCC---CCCCCCCCCEEEEEEHHHH-HHHHHHH-HHHH320 (330)
Q d20180708_4241ETLWLLRILSGVPHWTFVEAMTKFSTAAQRNGVPEFGHALSVDTV---PSPSFQGGRAHACQEDVWG-LSRLWHG-SLAQ320 (330)
T 2BG5_B241RMNEHVKEYYQPFHPAILRLVKMVIDAAHKEGKFAAMCGEMAGDPLAAVILLGLGLDEFSMSATSIPEIKNIIRNVEYEK320 (330)
T ss_pred241CCCCHHHHHCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECHHHHHHHHHHHHHHCHHH320 (330)
T ss_dssp241TTCGGGGGGCCTTSHHHHHHHHHHHHHHHHTTCEEEECSGGGGCHHHHHHHHHTTCCEEEECGGGHHHHHHHHTTSCHHH320 (330)
Q ss_pred321HHHHCCCCCC330 (330)
Q d20180708_4321ARASAPQFWG330 (330)
T 2BG5_B321AKEIAEKALN330 (330)
T ss_pred321HHHHHHHHHH330 (330)
T ss_dssp321HHHHHHHHHT330 (330)


No 10
> 3R4I_A    Citrate lyase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.24A {Burkholderia xenovorans}     Alignment in PIR format
MAC score = 81.66	Identity = 0.1

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHH---HHHCCCCEEEEECCCCCC---CHH80 (339)
Q d20180708_41SLQPELHNKCPVRLAMLTYPGNLRQNHKDAMADKSKTLMGAAHGTPSTDVTSW---MAAMKPRFVWIDVAHGCF---NRP80 (339)
T 3R4I_A1GMR----------------ALTPAEVLFDGEVPPAVLPACDHYAGSEKLMLKSLALQQQLGPVFDITLDCEDGAQVGREA80 (339)
T ss_pred1CCC----------------CCCHHHHHCCCCCCCCCCCEEECCCCCHHHHHHHHHCCCCCCCCCEEEEECCCCCCCCHHH80 (339)
T ss_dssp1UUU----------------CCCHHHHSCCUUUUCCCCCSEEEEECSHHHHHHHHHHHHHHCTTEEEEEESSTTSCSSCHH80 (339)
Q ss_pred81HHHHHHHHHHHCCCC-CEEEEEECCCCCCH-------HHHHHHCCCCCEEEEECCCCHHHHHHHHHHCCCCCCCCCCCCC160 (339)
Q d20180708_481ELHDRIHAAKHGSEG-SSLVIVPTPTHWFF-------PWYTAADAGCPKIVIPHVETVEEVLEFVLECYYGPIGRNEFSP160 (339)
T 3R4I_A81QHAELVASLLGSEHDRFGRVGVRIHDFDHAHWRDDVRLILRAAKRAPAYITLPKIRHVHDAAEMVAFIEAT---------160 (339)
T ss_pred81HHHHHHHHHHHCCCCCCCEEEEEECCCCCHHHHHHHHHHHCCCCCCCCEEEECCCCCHHHHHHHHHHHHHH---------160 (339)
T ss_dssp81HHHHHHHHHTTSSSCCSSCEEEECCCTTSTTHHHHHHHHHHHCSSCCSCEEECCUCCHHHHHHHHHHHHHH---------160 (339)
Q ss_pred161CCCCCCCCCCCCCCCCCHHCCCCCCCEEEEEEECCHHHHHHHHHHHCCCCCCEEEECCCCCCCCCH--HHHHHHH--CCC240 (339)
Q d20180708_4161WTFSPGIADAQLDPNVWYNVATSNAHVCIIDRIESTKLVENCGMSASMPENHGLMFQPGDYMIDET--LWLLRIL--SGV240 (339)
T 3R4I_A161----------------RR-ELGIAQPVPVQLLVETHGALTRVFDLAALPGVEALSFGLMDFVSAHDGAIPDTAMRSPGQF240 (339)
T ss_pred161----------------HH-HHCCCCCEEEEEEEEHHHHHHHHHHHHCCCCCCEEEECHHHHHHHHCCCCCCCCCCCCCCC240 (339)
T ss_dssp161----------------HH-HTTCSSCCCEEEEECSHHHHHTHHHHHTCTTEEEEEECHHHHHHTTTTSSCGGGGSTTHHH240 (339)
Q ss_pred241CCHHHHHHHHHHHHHHHHCCCCCEECCCCCC-CCCC------CCC--CCCCEEEEEEHHHHHHHHHHHHH----------320 (339)
Q d20180708_4241PHWTFVEAMTKFSTAAQRNGVPEFGHALSVD-TVPS------PSF--QGGRAHACQEDVWGLSRLWHGSL----------320 (339)
T 3R4I_A241DHPLVRRAKLEISAACHAYGKVPSHNVSTEVRDMSVVANDAARARNEFGYTRMWSIHPA--QIEAIVAAFAPRDEEITTA320 (339)
T ss_pred241CCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEECHH--HHHHHHHHHHCCHHHHHHH320 (339)
T ss_dssp241HSHHHHHHHHHHHHHHHHTTCEEEECCCCCSSCHHHHHHHHHHHHHTTCCSEEEESSHH--HHHHHHHHTSCCTHHHHHH320 (339)
Q ss_pred321----HHHHHH-C--CCCCC339 (339)
Q d20180708_4321----AQARAS-A--PQFWG339 (339)
T 3R4I_A321TEILLAAQSAQWGPTRYHD339 (339)
T ss_pred321HHHHHHHHHCCCCEEEECC339 (339)
T ss_dssp321HHHHHHHHHTTTSCEEETT339 (339)