TreeThreader - Results

  Job information

Job ID: d20180707
#Proteins: 4
Protein ID: d20180707_4
Fasta ID: seq4
Submission time: 2018-07-07 10:54:03 +0800
Finished time: 2019-02-17 14:59:04 +0800
Identical Job(s): NULL

  Alignments

1
50
100
150
165

  Build multi-template model (choose up to 5 templates)

Building multi-template model...

  Top 10 hits

Query:
Job ID  : d20180707_4
Length : 165
Sequence: RCNVLNALAYEDFVRLFGNLVEPYPLISNAIWSDRPFKGVADHMAKKSEFIHSLPDSGSEKILRCAPDLAGRDLQQGSIT SESQEAQSNAGMTQLDSEEIVHMERWNQEYKEEFDYIFVIKARLREFNDIVRQHSERLKNQRTAELECAIEVVKKFCYLR KHRIV

No Hit MAC Score Identity Cols Query HMM Template HMM

  Pairwise Query-Template Alignment