TreeThreader - Results

  Job information

Job ID: d20180629
#Proteins: 4
Protein ID: d20180629_2
Fasta ID: seq2
Submission time: 2018-06-29 10:54:03 +0800
Finished time: 2019-02-17 14:10:33 +0800
Identical Job(s): NULL

  Alignments

1
50
100
133

  Build multi-template model (choose up to 5 templates)

Building multi-template model...

  Top 10 hits

Query:
Job ID  : d20180629_2
Length : 133
Sequence: GCWATEVHAAVACWVLNQVMDGRNQLYMGVYIPDLEKKWPEILWRIPEHMALYSEFLGVRKWFCGTKMTYNIFLAYDELD QRHIFHPYCLDAGCNLKDFLAPIEGLKKIAANMKSSRALSHFYFSKLGTHSWV

No Hit MAC Score Identity Cols Query HMM Template HMM

  Pairwise Query-Template Alignment