TreeThreader - Results

  Job information

Job ID: d20180628
#Proteins: 4
Protein ID: d20180628_1
Fasta ID: seq1
Submission time: 2018-06-28 10:54:02 +0800
Finished time: 2019-02-17 14:24:10 +0800
Identical Job(s): NULL

  Alignments

1
50
100
150
200
250
300
350
364
1US3_A 1US3_A 1US2_A 1US2_A 3NJ3_B 3NJ3_B 3MUI_A 3MUI_A 3MS8_A 3MS8_A 1E5N_A 1E5N_A 3MMD_A 3MMD_A 1W2P_A 1W2P_A 1W2V_A 1W2V_A 1W3H_A 1W3H_A

  Build multi-template model (choose up to 5 templates)

                   
Download full-length structure

  Top 10 hits

Query:
Job ID  : d20180628_1
Length : 364
Sequence: APSANVDHLIDLRPSDFPIGSAVSNADSARYNLFTKSREQYKVKAMFPHLTAGNIMGMSYMQPTEGNHNFTGAKTFGTVN LENNATVSYCAWVWSSAYWVLNQHKNEAGPAGDFEAAEDTMYTTIVTHYEAKQNTASSDVVNEGRDDISERMFRTTDSAF CVKSGKGSVYIERVFQTARADDPAVILYYPDPFIEQNNAKTTWMVDKEKKFLARSIPIYGVMFQMHVCGNRPSIANISAA MKKVVDSTLLDPSTELDVAVCQEHCNDYPANKAVPLTEAYVLLQKKIYCDVVKGYCDMRFVNRRGGISVWGNTDANIFLW GLYREMFENEKISWHLSHTNNYNDKPAHRGFWDILIQTKCDNTH

No Hit MAC Score Identity Cols Query HMM Template HMM
11US3_A234.650.693641-36416-522
21US2_A226.460.663641-36412-522
33NJ3_B208.780.253251-36014-341
43MUI_A202.970.223292-3571-331
53MS8_A201.680.223292-3571-331
61E5N_A198.70.353377-3581-348
73MMD_A196.850.243361-3589-379
81W2P_A195.620.3533610-3581-348
91W2V_A195.370.3533610-3581-348
101W3H_A1940.343431-3586-359

  Pairwise Query-Template Alignment

No 1
> 1US3_A        Alignment in PIR format
MAC score = 234.65	Identity = 0.69

Download partial structureDownload full-length structure
Q ss_pred1C------CC-----CC---CC-------------------------------------CH--------------------80 (507)
Q d20180628_11A------PS-----AN---VD-------------------------------------HL--------------------80 (507)
T 1US3_A1ANGWRGNASGSTSHSGITYSADGVTFAALGDGVGAVFDIARPTTLEDAVIAMVVNVSAEFKASEANLQIFAQLKEDWSKG80 (507)
T ss_pred1CCCCCCCCCEEEECCCCEEEEECCCCCCCCCEEEEEEEEECCCEEEEEEEEEECCCCEEECCCCCCEEEEEEEECCCCCC80 (507)
T ss_dssp1SSSCEEEESSSSCCCCCEEETTEEEEECCSTTEEEEEECUUUUUUUUUUUCEEEEECHHHHHHTCEEEEEEEESSSTTCU80 (507)
Q ss_pred81------------------------------------------------------------------------HHHCCCCC160 (507)
Q d20180628_181------------------------------------------------------------------------IDLRPSDF160 (507)
T 1US3_A81EWDCLAASSELTADTDLTLTCTIDEDDDKFNQTARDVQVGIQAKGTPAGTITIKSVTITLAQEAYSANVDHLRDLAPSDF160 (507)
T ss_pred81CCEEEEEEEEECCCCCEEEEEEEECCCCCEEEEEEEEEEEEEECCCCCCCCEEEEEEEECCCCCCCCCCCHHHHHCCCCC160 (507)
T ss_dssp81CCCCCBCGGGCCUUUCEEECCCUUUUUUCCCCCUUCEEEEEEEESSCCSEEEEEEECCCUUUUCCCCCCSCGGGGCSSSC160 (507)
Q ss_pred161CEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCEEEEEECCCCCC240 (507)
Q d20180628_1161PIGSAVSNADSARYNLFTKSREQYKVKAMFPHLTAGNIMGMSYMQPTEGNHNFTGAKTFGTVNLENNATVSYCAWVWSSA240 (507)
T 1US3_A161PIGVAVSNTDSATYNLLTNSREQAVVKKHFNHLTAGNIMKMSYMQPTEGNFNFTNADAFVDWATENNMTVHGHALVWHSD240 (507)
T ss_pred161CCCEEECCCCCCCCCCCCCHHHHHHHHHHCCCEEECCCCEEHHEECCCCCCCHHHHHHHHHHHHHCCCEEEEEEEECCCC240 (507)
T ss_dssp161CEEEEEBCTTCTTTBTTTCHHHHHHHHHHCSEEEESSTTSHHHHCSBTTBCCCHHHHHHHHHHHHTTCEEEEEEEEECCG240 (507)
Q ss_pred241HHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCHHHHHHHHHH320 (507)
Q d20180628_1241YWVLNQHKNEAGPAGDFEAAEDTMYTTIVTHYEAKQNTASSDVVNEGRDDISERMFRTTDSAFCVKSGKGSVYIERVFQT320 (507)
T 1US3_A241YQVPNFMKNWAGSAEDFLAALDTHITTIVDHYEAKGNLVSWDVVNEAIDDNSPANFRTTDSAFYVKSGNSSVYIERAFQT320 (507)
T ss_pred241CCCCCHHCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCCCCHHHHHHCCCHHHHHHHHHH320 (507)
T ss_dssp241GGSCHHHHTCCSCHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCBCSSSSCCBCCTTCHHHHHTTSCSHHHHHHHHH320 (507)
Q ss_pred321HHHCCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEECC400 (507)
Q d20180628_1321ARADDPAVILYYPDPFIEQNNAKTTWMVDKEKKFLARSIPIYGVMFQMHVCGNRPSIANISAAMKKVVDSTLLDPSTELD400 (507)
T 1US3_A321ARAADPAVILYYNDYNIEQNNAKTTKMVDMVKDFQARSIPIDGVGFQMHVCMNYPSIANISAAMKKVVDLGLLVKITELD400 (507)
T ss_pred321HHHHCCCCCEEECCCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEC400 (507)
T ss_dssp321HHHHCTTSEEEEEESSTTSCSHHHHHHHHHHHHHHHTTCCCCEEEECCEEESSCSCHHHHHHHHHHHHTTTCEEEEEEEE400 (507)
Q ss_pred401CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCC480 (507)
Q d20180628_1401VAVCQEHCNDYPANKAVPLTEAYVLLQKKIYCDVVKGYCDMRFVNRRGGISVWGNTDANIFLWGLYREMFENEKISWHLS480 (507)
T 1US3_A401VAVNQPHCDAYPANKINPLTEAAQLAQKKRYCDVVKAYLDTVPVNQRGGISVWGTTDANTWLDGLYREQFEDEKISWPLL480 (507)
T ss_pred401CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCEE480 (507)
T ss_dssp401EESSCTTSTTTTTTCCCSCCHHHHHHHHHHHHHHHHHHHHHSCGGGEEEEEESCSBGGGCHHHHHTTTTTTTCCCCCCSS480 (507)
Q ss_pred481CCCCCCCCHHHHHHHHHHCCCCCCCCC507 (507)
Q d20180628_1481HTNNYNDKPAHRGFWDILIQTKCDNTH507 (507)
T 1US3_A481FDNNYNDKPALRGFADALIGTQCTNTH507 (507)
T ss_pred481ECCCCCCCHHHHHHHHHHCCCCCCCCE507 (507)
T ss_dssp481BCTTSCBCHHHHHHHHHHHTCCCCSCC507 (507)


No 2
> 1US2_A    Xylanase10C, endo-beta-1,4-xylanase; hydrolase, carbohydrate binding module, xylan degradation; HET: XYP; 1.85A {Cellvibrio japonicus} SCOP: b.18.1.11 c.1.8.3 PDB: 1us3_A     Alignment in PIR format
MAC score = 226.46	Identity = 0.66

Download partial structureDownload full-length structure
Q ss_pred1CCC---------------CCCCC----------------HH-----------------HHC----CCC--CCEEEEEC--80 (511)
Q d20180628_11APS---------------ANVDH----------------LI-----------------DLR----PSD--FPIGSAVS--80 (511)
T 1US2_A1EVDMANGWRGNASGSTSHSGITYSADGVTFAALGDGVGAVFDIARPTTLEDAVIAMVVNVSAEFKASEANLQIFAQLKED80 (511)
T ss_pred1EEECCCCCEECCCCCCCCCCEEEECCCEEEEEECCCCCCCCCCCCCCCCCCEEEEEEEEEEEEECCCCCCCCEEEEEECC80 (511)
T ss_dssp1BCCSSSSCEEEESSSSCCCCCEECSSCEEEECCSTTEEEEEEECSSEECTTCEEEEEEEECHHHHHTTCEEEEEEEETTE80 (511)
Q ss_pred81--------------------------------------------------------------------------------160 (511)
Q d20180628_181--------------------------------------------------------------------------------160 (511)
T 1US2_A81WSKGEWDCLAASSELTADTDLTLTCTIDEDDDKFNQTARDVQVGIQAKGTPAGTITIKSVTITLAQEAYSANVDHLRDLA160 (511)
T ss_pred81CCCCCEEEECCEEECCCCCCCEEEEEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEEEEEECCCCCCCCCCCHHHHH160 (511)
T ss_dssp81EEEEECCCCBCGGGCCUUCCEEEEEECCCSSCTTEESSCCEEEEEEEESSCCSEEEEEEEEEECUUUCCCCCCSCGGGGC160 (511)
Q ss_pred161-----------CCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCEEEEEECC240 (511)
Q d20180628_1161-----------NADSARYNLFTKSREQYKVKAMFPHLTAGNIMGMSYMQPTEGNHNFTGAKTFGTVNLENNATVSYCAWV240 (511)
T 1US2_A161PSDFPIGVAVSNTDSATYNLLTNSREQAVVKKHFNHLTAGNIMKMSYMQPTEGNFNFTNADAFVDWATENNMTVHGHALV240 (511)
T ss_pred161HCCCEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCHHHHCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEEE240 (511)
T ss_dssp161SSSCCEEEEEBCTTCTTTBTTTCHHHHHHHHHHCSEEEESSTTSHHHHCSBTTBCCCHHHHHHHHHHHHTTCEEEEEEEE240 (511)
Q ss_pred241CCCCHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCHHHHHH320 (511)
Q d20180628_1241WSSAYWVLNQHKNEAGPAGDFEAAEDTMYTTIVTHYEAKQNTASSDVVNEGRDDISERMFRTTDSAFCVKSGKGSVYIER320 (511)
T 1US2_A241WHSDYQVPNFMKNWAGSAEDFLAALDTHITTIVDHYEAKGNLVSWDVVNAAIDDNSPANFRTTDSAFYVKSGNSSVYIER320 (511)
T ss_pred241CCCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCCCCHHHHHHCCHHHHHHH320 (511)
T ss_dssp241CCCGGGSCHHHHTCCSCHHHHHHHHHHHHHHHHHHHHHHTCCCEEEEEESCBCSSSSCCBCCTTCHHHHHTTSCSHHHHH320 (511)
Q ss_pred321HHHHHHHCCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHCCCCCCE400 (511)
Q d20180628_1321VFQTARADDPAVILYYPDPFIEQNNAKTTWMVDKEKKFLARSIPIYGVMFQMHVCGNRPSIANISAAMKKVVDSTLLDPS400 (511)
T 1US2_A321AFQTARAADPAVILYYNDYNIEQNNAKTTKMVDMVKDFQARSIPIDGVGFQMHVCMNYPSIANISAAMKKVVDLGLLVKI400 (511)
T ss_pred321HHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHCCCCEEE400 (511)
T ss_dssp321HHHHHHHHCTTSEEEEEESSTTSCSHHHHHHHHHHHHHHHTTCCCCEEEECCEEESSCSCHHHHHHHHHHHHTTTCEEEE400 (511)
Q ss_pred401EECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCC480 (511)
Q d20180628_1401TELDVAVCQEHCNDYPANKAVPLTEAYVLLQKKIYCDVVKGYCDMRFVNRRGGISVWGNTDANIFLWGLYREMFENEKIS480 (511)
T 1US2_A401TELDVAVNQPHCDAYPANKINPLTEAAQLAQKKRYCDVVKAYLDTVPVNQRGGISVWGTTDANTWLDGLYREQFEDEKIS480 (511)
T ss_pred401EECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCC480 (511)
T ss_dssp401EEEEEESSCTTSTTTTTTCCCSCCHHHHHHHHHHHHHHHHHHHHHSCGGGEEEEEESCSBGGGCHHHHHTTTTTTTCCCC480 (511)
Q ss_pred481CCCCCCCCCCCCHHHHHHHHHHCCCCCCCCC511 (511)
Q d20180628_1481WHLSHTNNYNDKPAHRGFWDILIQTKCDNTH511 (511)
T 1US2_A481WPLLFDNNYNDKPALRGFADALIGTQCTNTH511 (511)
T ss_pred481CCCEECCCCCCCHHHHHHHHHHHHCCCCCCH511 (511)
T ss_dssp481CCSSBCTTSCBCHHHHHHHHHHHTCCCCSCC511 (511)


No 3
> 3NJ3_B        Alignment in PIR format
MAC score = 208.78	Identity = 0.25

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCHHHHCC-CCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHH80 (363)
Q d20180628_11APSANVDHLIDLRP-SDFPIGSAVSNADSARYNLFTKSREQYKVKAMFPHLTAGNIMGMSYMQPTEGNHNFTGAKTFGTV80 (363)
T 3NJ3_B1QGHMQNVSLRELAEKLNIYIGFAAINNFW---SLSDEEKYMEVARREFNILTPENQMKWDTIHPERDRYNFTPAEKHVEF80 (363)
T ss_pred1CCCCCCCCHHHHHHHCCCCEEEEEECCCC---CCCCCHHHHHHHHHHCCCCCCCCCCCCHHHCCCCCCCCCHHHHHHHHH80 (363)
T ss_dssp1UUCTTCCCHHHHHHHTTCEEEEEECTTGG---GSTTHHHHHHHHHHHCSEEEESSTTSHHHHCCBTTEEECHHHHHHHHH80 (363)
Q ss_pred81HHHCCCEEEEEECCCCC--CHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCC160 (363)
Q d20180628_181NLENNATVSYCAWVWSS--AYWVLNQHKNEAGPAGDFEAAEDTMYTTIVTHYEAKQNTASSDVVNEGRDDISERMFRTTD160 (363)
T 3NJ3_B81AEENNMIVHGHTLVWHNQLPGWIT----GREWTKEELLNVLEDHIKTVVSHFKG--RVKIWDVVNEAVSDS--GTYR--E160 (363)
T ss_pred81HHHCCCEEEEEEEECCCCCCHHHH----CCCCCHHHHHHHHHHHHHHHHHHCCC--CEEEEEEECCCCCCC--CCCC--C160 (363)
T ss_dssp81HHHTTCEEEEEEEECSSSCCHHHH----TSCCCHHHHHHHHHHHHHHHHHHTTT--TEEEEEEEECCBCSS--SSBC--C160 (363)
Q ss_pred161CCEEEECCCCHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCHHHH240 (363)
Q d20180628_1161SAFCVKSGKGSVYIERVFQTARADDPAVILYYPDPFIEQNNAKTTWMVDKEKKFLARSIPIYGVMFQMHVCGNRPSIANI240 (363)
T 3NJ3_B161SVW--YKTIGPEYIEKAFRWTKEADPDAILIYNDYSIEEINAKSNFVYNMIKELKEKGVPVDGIGFQMHIDYRGLNYDSF240 (363)
T ss_pred161CCH--HHCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEECCEECCCCCCHHHH240 (363)
T ss_dssp161CHH--HHHHCTHHHHHHHHHHHHHCTTSEEEEEESSCSSSSHHHHHHHHHHHHHHHTTCCCCEEEECCEEETTCCCHHHH240 (363)
Q ss_pred241HHHHHHHHHCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCC320 (363)
Q d20180628_1241SAAMKKVVDSTLLDPSTELDVAVCQEHCNDYPANKAVPLTEAYVLLQKKIYCDVVKGYCDMRFVNRRGGISVWGNTDANI320 (363)
T 3NJ3_B241RRNLERFAKLGLQIYITEMDVRIPLS-----------GSEDYYLKKQAEICAKIFDICLDN---PAVKAIQFWGFTDKYS320 (363)
T ss_pred241HHHHHHHHHCCCCEEEEEEEECCCCC-----------CCCCHHHHHHHHHHHHHHHHHHHC---CCEEEEEEECCCCCCC320 (363)
T ss_dssp241HHHHHHHHHTTCEEEEEEEEEEEESS-----------SCHHHHHHHHHHHHHHHHHHHHTC---TTEEEEEESCSBTTSC320 (363)
Q ss_pred321CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCC363 (363)
Q d20180628_1321FLWGLYREMFENEKISWHLSHTNNYNDKPAHRGFWDILIQTKC363 (363)
T 3NJ3_B321WVPGF----FK--GYGKALLFDENYNPKPCYYAIKEVLEKKIE363 (363)
T ss_pred321CCCCC----CC--CCCCCEEECCCCCCCHHHHHHHHHHHHHCC363 (363)
T ss_dssp321SHHHH----ST--TEECCSSBCTTSCBCHHHHHHHHHHHHHHC363 (363)


No 4
> 3MUI_A        Alignment in PIR format
MAC score = 202.97	Identity = 0.22

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCHHHHCCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH80 (358)
Q d20180628_11PSANVDHLIDLRPSDFPIGSAVSNADSARYNLFTKSREQYKVKAMFPHLTAGNIMGMSYMQPTEGNHNFTGAKTFGTVNL80 (358)
T 3MUI_A1MNSSLPSLRDVFANDFRIGAAVNPVTI------E--MQKQLLIDHVNSITAENHMKFEHLQPEEGKFTFQEADRIVDFAC80 (358)
T ss_pred1CCCCCHHHHHHHCCCCCEEEEECHHHH------C--CHHHHHHHHCCCCCCCCCCCCHHHCCCCCCCCHHHHHHHHHHHH80 (358)
T ss_dssp1UCTTSCCHHHHTTTTCEEEEEECHHHH------H--HTHHHHHHHCSEEEESSTTSHHHHCSBTTBCCCHHHHHHHHHHH80 (358)
Q ss_pred81HCCCEEEEEECCCCC--CHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC160 (358)
Q d20180628_181ENNATVSYCAWVWSS--AYWVLNQHKNEAGPAGDFEAAEDTMYTTIVTHYEAKQNTASSDVVNEGRDDISERMFRTTDSA160 (358)
T 3MUI_A81SHRMAVRGHTLVWHNQTPDWVFQDGQGHFVSRDVLLERMKCHISTVVRRYKG--KIYCWDVINEAVADEGDELLRPSKWR160 (358)
T ss_pred81HCCCEEEEEEEEECCCCCHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHCCC--CEEEEEEECCCCCCCCCCCCCCCHHH160 (358)
T ss_dssp81HTTCEEEEEEEEESSSCCGGGGBCSSSCBCCHHHHHHHHHHHHHHHHHHHTT--TCCEEEEEESCBCSSSSCSBCCCHHH160 (358)
Q ss_pred161EEEECCCCHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCHHHHHH240 (358)
Q d20180628_1161FCVKSGKGSVYIERVFQTARADDPAVILYYPDPFIEQNNAKTTWMVDKEKKFLARSIPIYGVMFQMHVCGNRPSIANISA240 (358)
T 3MUI_A161QII----GDDFMEQAFLYAYEADPDALLFYNDYNECF-PEKREKIFALVKSLRDKGIPIHGIGMQAHWSLTRPSLDEIRA240 (358)
T ss_pred161HCC----CHHHHHHHHHHHHHHCCCCEEEECCCCCCC-CHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCHHHHHH240 (358)
T ss_dssp161HHH----CTTHHHHHHHHHHHHCTTSEEEEEESSTTS-HHHHHHHHHHHHHHHTTTCCCCEEEECCEEESSSSCHHHHHH240 (358)
Q ss_pred241HHHHHHHCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCCCC320 (358)
Q d20180628_1241AMKKVVDSTLLDPSTELDVAVCQEHCNDYPANKAVPLTEAYVLLQKKIYCDVVKGYCDMRFVNRRGGISVWGNTDANIFL320 (358)
T 3MUI_A241AIERYASLGVVLHITALDVSMFEFH---DRRTDLAAPTSEMIERQAERYGQIFALFKEYR--DVIQSVTFWGIADDHTWL320 (358)
T ss_pred241HHHHHHHCCCCEEEEEEECCCCCCC---CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCC--CCCEEEEEECCCCCCCCC320 (358)
T ss_dssp241HHHHHHTTTCEEEEEEEEEESSCTT---CCCCCCSSCCHHHHHHHHHHHHHHHHHHHHTT--TTEEEEEESSSBTTSCGG320 (358)
Q ss_pred321CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCC358 (358)
Q d20180628_1321WGLYREMFENEKISWHLSHTNNYNDKPAHRGFWDILIQ358 (358)
T 3MUI_A321DN---FPVH-GRKNWPLLFDEQHKPKPAFWRA---VSV358 (358)
T ss_pred321CC---CCCC-CCCCCCCCCCCCCCCCHHHHHH---HHC358 (358)
T ss_dssp321GS---SSST-TCCCCCSSBCTTSCBCHHHHHH---HTC358 (358)


No 5
> 3MS8_A        Alignment in PIR format
MAC score = 201.68	Identity = 0.22

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCHHHHCCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH80 (358)
Q d20180628_11PSANVDHLIDLRPSDFPIGSAVSNADSARYNLFTKSREQYKVKAMFPHLTAGNIMGMSYMQPTEGNHNFTGAKTFGTVNL80 (358)
T 3MS8_A1MNSSLPSLRDVFANDFRIGAAVNPVTIE--------MQKQLLIDHVNSITAENHMKFEHLQPEEGKFTFQEADRIVDFAC80 (358)
T ss_pred1CCCCHHHHHHHHCCCCCEEEEECHHHHC--------HHHHHHHHHCCCCCCCCCCCHHHCCCCCCCCCCHHHHHHHHHHH80 (358)
T ss_dssp1UCTTSCCHHHHTTTTCEEEEEECHHHHH--------HTHHHHHHHCSEEEESSTTSHHHHCSBTTBCCCHHHHHHHHHHH80 (358)
Q ss_pred81HCCCEEEEEECCCCC--CHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC160 (358)
Q d20180628_181ENNATVSYCAWVWSS--AYWVLNQHKNEAGPAGDFEAAEDTMYTTIVTHYEAKQNTASSDVVNEGRDDISERMFRTTDSA160 (358)
T 3MS8_A81SHRMAVRGHTLVWHNQTPDWVFQDGQGHFVSRDVLLERMKCHISTVVRRYKG--KIYCWDVINEAVADEGNELLRPSKWR160 (358)
T ss_pred81HCCCEEEEEEEEECCCCCHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHCCC--CEEEEEEECCCCCCCCCCCCCCCHHH160 (358)
T ss_dssp81HTTCEEEEEEEEESSSCCGGGGBCTTSCBCCHHHHHHHHHHHHHHHHHHHTT--TCCEEEEEESCBCSSSSCSBCCCHHH160 (358)
Q ss_pred161EEEECCCCHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCHHHHHH240 (358)
Q d20180628_1161FCVKSGKGSVYIERVFQTARADDPAVILYYPDPFIEQNNAKTTWMVDKEKKFLARSIPIYGVMFQMHVCGNRPSIANISA240 (358)
T 3MS8_A161QI----IGDDFMEQAFLYAYEADPDALLFYNDYNECF-PEKREKIFALVKSLRDKGIPIHGIGMQAHWSLTRPSLDEIRA240 (358)
T ss_pred161HC----CCHHHHHHHHHHHHHHCCCCEEEECCCCCCC-CHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCHHHHHH240 (358)
T ss_dssp161HH----HCTTHHHHHHHHHHHHCTTSEEEEEESSTTS-HHHHHHHHHHHHHHHTTTCCCCEEEECCEEESSSSCHHHHHH240 (358)
Q ss_pred241HHHHHHHCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCCCC320 (358)
Q d20180628_1241AMKKVVDSTLLDPSTELDVAVCQEHCNDYPANKAVPLTEAYVLLQKKIYCDVVKGYCDMRFVNRRGGISVWGNTDANIFL320 (358)
T 3MS8_A241AIERYASLGVVLHITALDVSMFEFHD---RRTDLAAPTSEMIERQAERYGQIFALFKEYR--DVIQSVTFWGIADDHTWL320 (358)
T ss_pred241HHHHHHHCCCCEEEEEEECCCCCCCC---CCCCCCCCCHHHHHHHHHHHHHHHHHHHHCC--CCCEEEEEECCCCCCCCC320 (358)
T ss_dssp241HHHHHHTTTCEEEEEEEEEESSCTTC---CCCCCSSCCHHHHHHHHHHHHHHHHHHHHTT--TTEEEEEESSSBTTSCGG320 (358)
Q ss_pred321CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCC358 (358)
Q d20180628_1321WGLYREMFENEKISWHLSHTNNYNDKPAHRGFWDILIQ358 (358)
T 3MS8_A321DN---FPVHG-RKNWPLLFDEQHKPKPAFWRAV---SV358 (358)
T ss_pred321CC---CCCCC-CCCCCCCCCCCCCCCHHHHHHH---HC358 (358)
T ss_dssp321GT---SSSTT-CCCCCSSBCTTSCBCHHHHHHH---TC358 (358)


No 6
> 1E5N_A        Alignment in PIR format
MAC score = 198.7	Identity = 0.35

Download partial structureDownload full-length structure
Q ss_pred1CCHHHHCCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCE80 (363)
Q d20180628_11DHLIDLRPSDFPIGSAVSNADSARYNLFTKSREQYKVKAMFPHLTAGNIMGMSYMQPTEGNHNFTGAKTFGTVNLENNAT80 (363)
T 1E5N_A1NGLASL--ADFPIGVAVAASG-GNADIFTSSARQNIVRAEFNQITAENIMKMSYMY-SGSNFSFTNSDRLVSWAAQNGQT80 (363)
T ss_pred1CCCCCC--CCCEEEEEECCCC-CCCCCCCCHHHHHHHHHCCCCEEECCCCCHHHHC-CCCCCCHHHHHHHHHHHHHCCCE80 (363)
T ss_dssp1UCGGGG--CSSCEEEEEBCSS-STTBTTTCHHHHHHHHHHCSEEEESSTTSGGGGE-ETTEECCHHHHHHHHHHHHTTCE80 (363)
Q ss_pred81EEEEECCCCCCHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCC-----CCCCCCCCEE160 (363)
Q d20180628_181VSYCAWVWSSAYWVLNQHKNEAGPAGDFEAAEDTMYTTIVTHYEAKQNTASSDVVNEGRDDISER-----MFRTTDSAFC160 (363)
T 1E5N_A81VHGHALVWHPSYQLPNWASD-S--NANFRQDFARHIDTVAAHFAG--QVKSWDVVNEALFDSADDPDGRGSANGYRQSVF160 (363)
T ss_pred81EEEEEEECCCCCCCCCCCCC-C--HHHHHHHHHHHHHHHHHHCCC--CEEEEEEEECCCCCCCCCCCCCCCCCCCHHHHH160 (363)
T ss_dssp81EEEEEEEECCGGGCCTTCST-T--CTTHHHHHHHHHHHHHHHTTT--TCSEEEEEESCBCCTTCCTTCCCCBTTBCCCHH160 (363)
Q ss_pred161EECCCCHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCHHHHHHHH240 (363)
Q d20180628_1161VKSGKGSVYIERVFQTARADDPAVILYYPDPFIEQNNAKTTWMVDKEKKFLARSIPIYGVMFQMHVCGNRPSIANISAAM240 (363)
T 1E5N_A161YRQFGGPEYIDEAFRRARAADPTAELYYNDFNTEENGAKTTALVNLVQRLLNNGVPIDGVGFQMHVMNDYPSIANIRQAM240 (363)
T ss_pred161HHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCHHHHHHHH240 (363)
T ss_dssp161HHHHTSTHHHHHHHHHHHHHCTTSEEEEEESSTTSCSHHHHHHHHHHHHHHHTTCCCCEEEECCEEESSSSCHHHHHHHH240 (363)
Q ss_pred241HHHHHCC--CCCCEEECCCCCCCCCCC----CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCC320 (363)
Q d20180628_1241KKVVDST--LLDPSTELDVAVCQEHCN----DYPANKAVPLTEAYVLLQKKIYCDVVKGYCDMRFVNRRGGISVWGNTDA320 (363)
T 1E5N_A241QKIVALSPTLKIKITCLDVRLNNPYDGNSSNDYTNRNDCAVSCAGLDRQKARYKEIVQAYLEVVPPGRRGGITVWGIADP320 (363)
T ss_pred241HHHHHHCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCC320 (363)
T ss_dssp241HHHHHTCSSCEEEEEEEEEESCCTTSSCSTTCCCSTTTTSSCCHHHHHHHHHHHHHHHHHHHHSCTTCEEEEEESCSBGG320 (363)
Q ss_pred321CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCC363 (363)
Q d20180628_1321NIFLWGLYREMFENEKISWHLSHTNNYNDKPAHRGFWDILIQT363 (363)
T 1E5N_A321DSWLYT-----HQ-NLPDWPLLFNDNLQPKPAYQGVVEALSGR363 (363)
T ss_pred321CCCCCC-----CC-CCCCCCEEECCCCCCCHHHHHHHHHHHCC363 (363)
T ss_dssp321GSTTSE-----ET-TEECCCSSBCTTSCBCHHHHHHHHHHCCU363 (363)


No 7
> 3MMD_A        Alignment in PIR format
MAC score = 196.85	Identity = 0.24

Download partial structureDownload full-length structure
Q ss_pred1CCC---CCCCCHHHHCCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHH80 (393)
Q d20180628_11APS---ANVDHLIDLRPSDFPIGSAVSNADSARYNLFTKSREQYKVKAMFPHLTAGNIMGMSYMQPTEGNHNFTGAKTFG80 (393)
T 3MMD_A1KPHISALNAPQLDQRYKNEFTIGAAVEPYQ------LQNEKDVQMLKRHFNSIVAENVMKPISIQPEEGKFNFEQADRIV80 (393)
T ss_pred1CCCCCCCCCHHHHHHHCCCCCEEEEECHHH------CCCHHHHHHHHHHCCCCCCCCCCCCHHHCCCCCCCCCHHHHHHH80 (393)
T ss_dssp1CCCCBGGGSCCHHHHHTTTCEEEEEECGGG------GGSHHHHHHHHHHCSEEEESSTTSHHHHCSBTTBCCCHHHHHHH80 (393)
Q ss_pred81HHHHHCCCEEEEEECCCCC--CHHCCCCCCC-------CCCCC----CCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC160 (393)
Q d20180628_181TVNLENNATVSYCAWVWSS--AYWVLNQHKN-------EAGPA----GDFEAAEDTMYTTIVTHYEAKQNTASSDVVNEG160 (393)
T 3MMD_A81KFAKANGMDIRFHTLVWHSQVPQWFFLDKEGKPMVNETDPVKREQNKQLLLKRLETHIKTIVERYKD--DIKYWDVVNEV160 (393)
T ss_pred81HHHHHCCCEEEEEEEECCCCCCHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCC--CEEEEEEEEEE160 (393)
T ss_dssp81HHHHHTTCEEEEEEEECSSSCCGGGGBCTTSCBGGGCCCHHHHHHHHHHHHHHHHHHHHHHHHHHTT--TCCEEEEEESC160 (393)
Q ss_pred161CCCCCCCCCCCCCCCEEEECCCCHHHHHHHHHHHHHC-CCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEE240 (393)
Q d20180628_1161RDDISERMFRTTDSAFCVKSGKGSVYIERVFQTARAD-DPAVILYYPDPFIEQNNAKTTWMVDKEKKFLARSIPIYGVMF240 (393)
T 3MMD_A161VGDD--GKLRN--S--PWYQIAGIDYIKVAFQAARKYGGDNIKLYMNDYNTEVE-PKRTALYNLVKQLKEEGVPIDGIGH240 (393)
T ss_pred161ECCC--CCCCC--C--HHHHHCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCC-HHHHHHHHHHHHHHHCCCEECEEEE240 (393)
T ss_dssp161BCTT--SSBCC--S--HHHHHHTTHHHHHHHHHHHHHHCTTSEEEEEESCTTST-THHHHHHHHHHHHHHTTCCCCEEEE240 (393)
Q ss_pred241CCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCC320 (393)
Q d20180628_1241QMHVCGNRPSIANISAAMKKVVDSTLLDPSTELDVAVCQEHCNDYPANKAVPLTEAYVLLQKKIYCDVVKGYCDMRFVNR320 (393)
T 3MMD_A241QSHIQIGAPSEAEIEKTINMFAALGLDNQITELDVSMYGWPPRAYPTYD--AIPKQKFLDQAARYDRLFKLYEKLSD--K320 (393)
T ss_pred241CCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCCC--CHHHHHHHHHHHHHHHHHHHHHHHCC--C320 (393)
T ss_dssp241CCEECSSCSCHHHHHHHHHHHHHTTCEEEEEEEEECSSCSSCCCBSSGG--GSCHHHHHHHHHHHHHHHHHHHHTGG--G320 (393)
Q ss_pred321CCEEEEECCCCCCCCCCC----CCCC---C-----------CCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCC393 (393)
Q d20180628_1321RGGISVWGNTDANIFLWG----LYRE---M-----------FENEKISWHLSHTNNYNDKPAHRGFWDILIQT393 (393)
T 3MMD_A321ISNVTFWGIADNHTWLDSRADVYYDANGNVVVDPNAPYAKVEKGKGKDAPFVFGPDYKV---KPAYWAIIDHK393 (393)
T ss_pred321EEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCC---CHHHHHHHCCC393 (393)
T ss_dssp321EEEEEESSSSTTSCGGGGGCCEEECTTSCEECCTTSCCSEEETTCSBCCCSSBCTTSBB---CHHHHHHHSCC393 (393)


No 8
> 1W2P_A        Alignment in PIR format
MAC score = 195.62	Identity = 0.35

Download partial structureDownload full-length structure
Q ss_pred1HHHCC-CCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCEEE80 (361)
Q d20180628_11IDLRP-SDFPIGSAVSNADSARYNLFTKSREQYKVKAMFPHLTAGNIMGMSYMQPTEGNHNFTGAKTFGTVNLENNATVS80 (361)
T 1W2P_A1MGLASLADFPIGVAVAASGGN-ADIFTSSARQNIVRAEFNQITAENIMKMSYMYS-GSNFSFTNSDRLVSWAAQNGQTVH80 (361)
T ss_pred1CCCCCCCCCEEEEEECCCCCC-CCCCCCHHHHHHHHHCCCEEEECCCCCHHHHCC-CCCCCHHHHHHHHHHHHHCCCEEE80 (361)
T ss_dssp1UCGGGGCSSCEEEEEBCSSST-TBTTTCHHHHHHHHHHCSEEEESSTTSGGGGEE-TTEECCHHHHHHHHHHHHTTCEEE80 (361)
Q ss_pred81EEECCCCCCHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCC----CC-CCCCCCCCEEEE160 (361)
Q d20180628_181YCAWVWSSAYWVLNQHKNEAGPAGDFEAAEDTMYTTIVTHYEAKQNTASSDVVNEGRDDIS----ER-MFRTTDSAFCVK160 (361)
T 1W2P_A81GHALVWHPSYQLPNWASD-S--NANFRQDFARHIDTVAAHFAG--QVKSWDVVNEALFDSADDPDGRGSANGYRQSVFYR160 (361)
T ss_pred81EEEEECCCCCCCCCCCCC-C--HHHHHHHHHHHHHHHHHHCCC--CEEEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHH160 (361)
T ss_dssp81EEEEECCCGGGCCTTCST-T--CTTHHHHHHHHHHHHHHHTTT--TCSEEEEEECCBCCGGGCTTCCCCBTTBCCCHHHH160 (361)
Q ss_pred161CCCCHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCHHHHHHHHHH240 (361)
Q d20180628_1161SGKGSVYIERVFQTARADDPAVILYYPDPFIEQNNAKTTWMVDKEKKFLARSIPIYGVMFQMHVCGNRPSIANISAAMKK240 (361)
T 1W2P_A161QFGGPEYIDEAFRRARAADPTAELYYNDFNTEENGAKTTALVNLVQRLLNNGVPIDGVGFQMHVMNDYPSIANIRQAMQK240 (361)
T ss_pred161HHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCHHHHHHHHHH240 (361)
T ss_dssp161HHTSTHHHHHHHHHHHHHCTTSEEEEEESSTTSCSHHHHHHHHHHHHHHHTTCCCCEEEECCEEESSSSCHHHHHHHHHH240 (361)
Q ss_pred241HHHCC--CCCCEEECCCCCCCCCCCC----CCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCC320 (361)
Q d20180628_1241VVDST--LLDPSTELDVAVCQEHCND----YPANKAVPLTEAYVLLQKKIYCDVVKGYCDMRFVNRRGGISVWGNTDANI320 (361)
T 1W2P_A241IVALSPTLKIKITELDVRLNNPYDGNSSNDYTNRNDCAVSCAGLDRQKARYKEIVQAYLEVVPPGRRGGITVWGIADPDS320 (361)
T ss_pred241HHHHCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCC320 (361)
T ss_dssp241HHTTCSSCEEEEEEEEEESCCTTSSCTTSCCCSGGGGSSCCHHHHHHHHHHHHHHHHHHHHSCTTCEEEEEESCSBGGGS320 (361)
Q ss_pred321CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCC361 (361)
Q d20180628_1321FLWGLYREMFENEKISWHLSHTNNYNDKPAHRGFWDILIQT361 (361)
T 1W2P_A321WLY-----TH-QNLPDWPLLFNDNLQPKPAYQGVVEALSGR361 (361)
T ss_pred321CCC-----CC-CCCCCCCEEECCCCCCCHHHHHHHHHHHCC361 (361)
T ss_dssp321TTS-----EE-TTEECCCSSBCTTSCBCHHHHHHHHHHHCU361 (361)


No 9
> 1W2V_A        Alignment in PIR format
MAC score = 195.37	Identity = 0.35

Download partial structureDownload full-length structure
Q ss_pred1HHHCC-CCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCEEE80 (361)
Q d20180628_11IDLRP-SDFPIGSAVSNADSARYNLFTKSREQYKVKAMFPHLTAGNIMGMSYMQPTEGNHNFTGAKTFGTVNLENNATVS80 (361)
T 1W2V_A1MGLASLADFPIGVAVAASG-GNADIFTSSARQNIVRAEFNQITAENIMKMSYMYS-GSNFSFTNSDRLVSWAAQNGQTVH80 (361)
T ss_pred1CCCCCCCCCEEEEEEECCC-CCCCCCCCHHHHHHHHHCCCEEEECCCCCHHHHCC-CCCCCHHHHHHHHHHHHHCCCEEE80 (361)
T ss_dssp1UCGGGGCSSCEEEEEBCSS-STTBTTTCHHHHHHHHHHCSEEEESSTTSGGGGEE-TTEECCHHHHHHHHHHHHTTCEEE80 (361)
Q ss_pred81EEECCCCCCHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCC----C-CCCCCCCCEEEE160 (361)
Q d20180628_181YCAWVWSSAYWVLNQHKNEAGPAGDFEAAEDTMYTTIVTHYEAKQNTASSDVVNEGRDDISE----R-MFRTTDSAFCVK160 (361)
T 1W2V_A81GHTLVWHPSYQLPNWASD-S--NANFRQDFARHIDTVAAHFAG--QVKSWDVVNEALFDSADDPDGRGSANGYRQSVFYR160 (361)
T ss_pred81EEEEECCCCCCCCCCCCC-C--HHHHHHHHHHHHHHHHHHCCC--CEEEEEEEECCCCCCCCCCCCCCCCCCHHHHHHHH160 (361)
T ss_dssp81EEEEECCCGGGCCTTCST-T--CTTHHHHHHHHHHHHHHHTTT--TCSEEEEEECCBCCGGGCTTCCCEETTEECCHHHH160 (361)
Q ss_pred161CCCCHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCHHHHHHHHHH240 (361)
Q d20180628_1161SGKGSVYIERVFQTARADDPAVILYYPDPFIEQNNAKTTWMVDKEKKFLARSIPIYGVMFQMHVCGNRPSIANISAAMKK240 (361)
T 1W2V_A161QFGGPEYIDEAFRRARAADPTAELYYNDFNTEENGAKTTALVNLVQRLLNNGVPIDGVGFQMHVMNDYPSIANIRQAMQK240 (361)
T ss_pred161HHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCHHHHHHHHHH240 (361)
T ss_dssp161HHTSTHHHHHHHHHHHHHCTTSEEEEEESSTTSCSHHHHHHHHHHHHHHHTTCCCCEEEECCEEESSSSCHHHHHHHHHH240 (361)
Q ss_pred241HHHCC--CCCCEEECCCCCCCCCCC----CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCC320 (361)
Q d20180628_1241VVDST--LLDPSTELDVAVCQEHCN----DYPANKAVPLTEAYVLLQKKIYCDVVKGYCDMRFVNRRGGISVWGNTDANI320 (361)
T 1W2V_A241IVALSPTLKIKITELDVRLNNPYDGNSSNEYTNRNDCAVSCAGLDRQKARYKEIVQAYLEVVPPGRRGGITVWGIADPDS320 (361)
T ss_pred241HHHHCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCEECCCC320 (361)
T ss_dssp241HHTTCSSCEEEEEEEEEESCCTTSSCTTSCCCSGGGGSSCCHHHHHHHHHHHHHHHHHHHHSCGGGEEEEEESCSBGGGS320 (361)
Q ss_pred321CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCC361 (361)
Q d20180628_1321FLWGLYREMFENEKISWHLSHTNNYNDKPAHRGFWDILIQT361 (361)
T 1W2V_A321WLYT-----H-QNLPDWPLLFNDNLQPKPAYQGVVEALSGR361 (361)
T ss_pred321CCCC-----C-CCCCCCCEEECCCCCCCHHHHHHHHHHHCC361 (361)
T ss_dssp321TTSE-----E-TTEECCCSSBCTTSCBCHHHHHHHHHHHCU361 (361)


No 10
> 1W3H_A        Alignment in PIR format
MAC score = 194	Identity = 0.34

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCHHHHCCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH80 (369)
Q d20180628_11APSANVDHLIDLRPSDFPIGSAVSNADSARYNLFTKSREQYKVKAMFPHLTAGNIMGMSYMQPTEGNHNFTGAKTFGTVN80 (369)
T 1W3H_A1TLEDRSPGLASLA--DFPIGVAVAASGG-NADIFTSSARQNIVRAEFNQITAENIMKMSYMYS-GSNFSFTNSDRLVSWA80 (369)
T ss_pred1CCCCCCCCHHHHH--CCCEEEEEECCCC-CCCCCCCHHHHHHHHHCCCCEEECCCCCHHHHCC-CCCCCHHHHHHHHHHH80 (369)
T ss_dssp1UUUUUCCCGGGGC--SSCEEEEEBCSSS-TTBTTTCHHHHHHHHHHCSEEEESSTTSSGGGEE-TTEECCHHHHHHHHHH80 (369)
Q ss_pred81HHCCCEEEEEECCCCCCHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCC----CC-CCC160 (369)
Q d20180628_181LENNATVSYCAWVWSSAYWVLNQHKNEAGPAGDFEAAEDTMYTTIVTHYEAKQNTASSDVVNEGRDDISE----RM-FRT160 (369)
T 1W3H_A81AQNGQTVHGHTLVWHPSYQLPNWASD-S--NANFRQDFARHIDTVAAHFAG--QVKSWDVVNEALFDSADDPDGRGSANG160 (369)
T ss_pred81HHCCCEEEEEEEECCCCCCCCCCCCC-C--HHHHHHHHHHHHHHHHHHCCC--CEEEEEEEECCCCCCCCCCCCCCCCCC160 (369)
T ss_dssp81HHTTCEEEEEEEECCCGGGCCTTCST-T--CTTHHHHHHHHHHHHHHHTTT--TCSEEEEEECCBCCGGGCTTCCCCBTT160 (369)
Q ss_pred161CCCCEEEECCCCHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCHH240 (369)
Q d20180628_1161TDSAFCVKSGKGSVYIERVFQTARADDPAVILYYPDPFIEQNNAKTTWMVDKEKKFLARSIPIYGVMFQMHVCGNRPSIA240 (369)
T 1W3H_A161YRQSVFYRQFGGPEYIDEAFRRARAADPTAELYYNDFNTEENGAKTTALVNLVQRLLNNGVPIDGVGFQMHVMNDYPSIA240 (369)
T ss_pred161HHHHHHHHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCHH240 (369)
T ss_dssp161BCCCHHHHHHTSTHHHHHHHHHHHHHCTTSEEEEEESSTTSCSHHHHHHHHHHHHHHHTTCCCCEEEECCEEESSSSCHH240 (369)
Q ss_pred241HHHHHHHHHHHCC--CCCCEEECCCCCCCCCCCC----CCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEE320 (369)
Q d20180628_1241NISAAMKKVVDST--LLDPSTELDVAVCQEHCND----YPANKAVPLTEAYVLLQKKIYCDVVKGYCDMRFVNRRGGISV320 (369)
T 1W3H_A241NIRQAMQKIVALSPTLKIKITELDVRLNNPYDGNSSNNYTNRNDCAVSCAGLDRQKARYKEIVQAYLEVVPPGRRGGITV320 (369)
T ss_pred241HHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEE320 (369)
T ss_dssp241HHHHHHHHHHTTCSSCEEEEEEEEEESCCGGGSCSTTCCCSTTTTSSCCHHHHHHHHHHHHHHHHHHHHSCTTCEEEEEE320 (369)
Q ss_pred321ECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCC369 (369)
Q d20180628_1321WGNTDANIFLWGLYREMFENEKISWHLSHTNNYNDKPAHRGFWDILIQT369 (369)
T 1W3H_A321WGIADPDSWLY-----THQ-NLPDWPLLFNDNLQPKPAYQGVVEALSGR369 (369)
T ss_pred321CCEECCCCCCC-----CCC-CCCCCCEEECCCCCCCHHHHHHHHHHCCC369 (369)
T ss_dssp321SCSBGGGSTTS-----EET-TEECCCSSBCTTCCBCHHHHHHHHHHHCU369 (369)