TreeThreader - Results

  Job information

Job ID: d20180625
#Proteins: 4
Protein ID: d20180625_2
Fasta ID: seq2
Submission time: 2018-06-25 10:54:02 +0800
Finished time: 2019-02-17 14:02:19 +0800
Identical Job(s): NULL

  Alignments

1
50
100
150
200
250
278
1RP0_A 1RP0_A 3JSK_C 3JSK_C 3FPZ_B 3FPZ_B 2GJC_A 2GJC_A 2GMJ_A 2GMJ_A 3J02_K 3J02_K 1QO8_A 1QO8_A 3CIR_A 3CIR_A 1Q3R_A 1Q3R_A 3P4R_A 3P4R_A

  Build multi-template model (choose up to 5 templates)

                   
Download full-length structure

  Top 10 hits

Query:
Job ID  : d20180625_2
Length : 278
Sequence: YDLQAFHFDPNKESIVSMEMCMRYPTDWITYAECDVVVYAYGSAGLSAAYENSFNPNTQVDIIEQSREPGMGAWLGKQKF SLMIVEKHAALFLDEIVVAYDDQSTFDVVFHAILFTVTIMSKLLAPPIVPLMSSVAACDYTVIGHRVGGMVTNEALVAKF NATQGNMDPPVMRRKIAWSSMNHDGPPGDTGVVNLGSIGMDDHVFGMKASHMNEAECASVRPVREVCVGMIVIGMEKKEP EIGPNVGPTFYAMMISGPIASQYYLKAWGLPNAIGLTL

No Hit MAC Score Identity Cols Query HMM Template HMM
11RP0_A150.040.672781-2787-284
23JSK_C128.230.42781-27847-344
33FPZ_B116.460.392701-27024-326
42GJC_A102.110.372701-27024-326
52GMJ_A64.330.152721-2785-401
63J02_K61.150.082601-277134-491
71QO8_A60.980.132641-27183-566
83CIR_A60.40.112663-2781-423
91Q3R_A60.360.112701-278140-526
103P4R_A59.490.12673-2781-422

  Pairwise Query-Template Alignment

No 1
> 1RP0_A    ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6     Alignment in PIR format
MAC score = 150.04	Identity = 0.67

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHCCCCCCCEEEEEEECCCCCCCCCCCCCCC80 (278)
Q d20180625_21YDLQAFHFDPNKESIVSMEMCMRYPTDWITYAECDVVVYAYGSAGLSAAYENSFNPNTQVDIIEQSREPGMGAWLGKQKF80 (278)
T 1RP0_A1YDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSAAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLF80 (278)
T ss_pred1CCCCCEECCCCCCCHHHHHHHHHHHHHCCCCCCCCEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCEECCCCH80 (278)
T ss_dssp1CCTTSCCCCCCCHHHHHHHHHHHHHHHHHHHTEEEEEEECCSHHHHHHHHHHHTSTTSCEEEEESSSSCCTTTTCCSTTC80 (278)
Q ss_pred81HHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCCCCCCCEEEEEEEEECCEEEEEEECCCCCCCC160 (278)
Q d20180625_281SLMIVEKHAALFLDEIVVAYDDQSTFDVVFHAILFTVTIMSKLLAPPIVPLMSSVAACDYTVIGHRVGGMVTNEALVAKF160 (278)
T 1RP0_A81SAMIVRKPAHLFLDEIGVAYDEQDTYVVVKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKGNRVGGVVTNWALVAQN160 (278)
T ss_pred81HHHHHCHHHHHHHHHCCCCEECCCCEEEEECHHHHHHHHHHHHHHCCCCEEECCCEEEEEEEECCEEEEEEEECCCCCCC160 (278)
T ss_dssp81CCEEEETTTHHHHHHHTCCCEECSSEEEESCHHHHHHHHHHHHHTSTTEEEEETEEEEEEEEETTEEEEEEEEEHHHHTC160 (278)
Q ss_pred161CCCCCCCCCCCEEEEEEECCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCCCEEEEEEECCCC240 (278)
Q d20180625_2161NATQGNMDPPVMRRKIAWSSMNHDGPPGDTGVVNLGSIGMDDHVFGMKASHMNEAECASVRPVREVCVGMIVIGMEKKEP240 (278)
T 1RP0_A161HHTQSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEI240 (278)
T ss_pred161CCCCCCCCCEEEECCEEEECCCCCCCCCCCHHHHHCCCCCCCCCCCCHHHHHHHHCCCEEECCCCCCCCCEEECCCCCCC240 (278)
T ss_dssp161TTTSSCCCCEEEEEEEEEECCCSSSTTTTHHHHHHHHTTSSSCCCCCEEECHHHHHHHHHHHCEEEETTEEECTHHHHHH240 (278)
Q ss_pred241CCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCC278 (278)
Q d20180625_2241EIGPNVGPTFYAMMISGPIASQYYLKAWGLPNAIGLTL278 (278)
T 1RP0_A241DGAPRMGPTFGAMMISGQKAGQLALKALGLPNAIDGTL278 (278)
T ss_pred241CCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCC278 (278)
T ss_dssp241HTCEECCSCCHHHHHHHHHHHHHHHHHTTCCCTTTTCC278 (278)


No 2
> 3JSK_C        Alignment in PIR format
MAC score = 128.23	Identity = 0.4

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHCC-CCCCCEEEEEEECCCCCCCCCCCCCC80 (298)
Q d20180625_21YDLQAFHFDPNKESIVSMEMCMRYPTDWITYAECDVVVYAYGSAGLSAAYENS-FNPNTQVDIIEQSREPGMGAWLGKQK80 (298)
T 3JSK_C1LGTDAFTFSPIRESTVSRAMTRRYFADLDAHAETDIVIVGAGSCGLSAAYVLSTLRPDLRITIVEAGVAPGGGAWLGGQL80 (298)
T ss_pred1CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCEEEECCCE80 (298)
T ss_dssp1TTSTTCCCCCCCHHHHHHHHHHHHHHHHHHTTBCSEEEECCBHHHHHHHHHHHHHCTTSCEEEEESSSSCBTTTTCCBTT80 (298)
Q ss_pred81CHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCCCCCCCEEEEEEEEECC--------------160 (298)
Q d20180625_281FSLMIVEKHAALFLDEIVVAYDDQSTFDVVFHAILFTVTIMSKLLAPPIVPLMSSVAACDYTVIGH--------------160 (298)
T 3JSK_C81FSAMVMRKPADVFLDEVGVPYEDEGDYVVVKHAALFTSTVLSKVLQRPNVKLFNATTVEDLITRKHHAESSSSSDDGEAE160 (298)
T ss_pred81ECHHHHHHHHHHHHHHCCCEEECCCCEEEECCCCCCCCCCCCHHHCCCCCEEEEEEEEEEEEECCCCCCCCCCCCCCCCC160 (298)
T ss_dssp81CCCEEEETTTHHHHHHHTCCCEECSSEEEESCHHHHHHHHHHHHTTSTTEEEEETEEEEEEEEEECUUUUUUUUUUUUUU160 (298)
Q ss_pred161-----EEEEEEECCCCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCEE240 (298)
Q d20180625_2161-----RVGGMVTNEALVAKFNATQGNMDPPVMRRKIAWSSMNHDGPPGDTGVVNLGSIGMDDHVFGMKASHMNEAECASV240 (298)
T 3JSK_C161DEAKVRIAGVVTNWTLVSMHHDDQSAMDPNTINAPVIISTTGHDGPFGAFSVKRLVSMKQMERLNGMRGLDMQSAEDAIV240 (298)
T ss_pred161CCCCCEEEEEEECCCHHCCCCCCCCCCCCEEEEECEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCEE240 (298)
T ss_dssp161UUCCEEEEEEEEEEHHHHTTSSSSSCCBCEEEECSEEEECCCSSSSSSCHHHHHHHHTTCSSCCCCCCCBCHHHHHHHHH240 (298)
Q ss_pred241CCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCC298 (298)
Q d20180625_2241RPVREVCVGMIVIGMEKKEPEIGPNVGPTFYAMMISGPIASQYYLKAWGLPNAIGLTL298 (298)
T 3JSK_C241NNTREIVPGLIVGGMELSEIDGANRMGPTFGAMALSGVKAAHEAIRVFDLRKAQNDKC298 (298)
T ss_pred241ECCCEECCCEEECCHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCHHHCCCC298 (298)
T ss_dssp241HHCEEEETTEEECTHHHHHHHTCCBCCSCCHHHHHHHHHHHHHHHHHHHHHHHHHCUU298 (298)


No 3
> 3FPZ_B        Alignment in PIR format
MAC score = 116.46	Identity = 0.39

Download partial structureDownload full-length structure
Q ss_pred1CCC---------CCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHCC-CCCCCEEEEEEECCCCC80 (303)
Q d20180625_21YDL---------QAFHFDPNKESIVSMEMCMRYPTDWITYAECDVVVYAYGSAGLSAAYENS-FNPNTQVDIIEQSREPG80 (303)
T 3FPZ_B1HCLSDIVKKEDWSDFKFAPIRESTVSRAMTSRYFKDLDKFAVSDVIIVGAGSSGLSAAYVIAKNRPDLKVCIIESSVAPG80 (303)
T ss_pred1CCCCCCCCCCCCCCCEECCCCHHHHHHHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHHHHHHHCCCCEEEEEECCCCCC80 (303)
T ss_dssp1CTTTTTCCSTTCTTCCCCCCCHHHHHHHHHHHHHHHHHHTTEESEEEECCSHHHHHHHHHHHHHCTTSCEEEECSSSSCC80 (303)
Q ss_pred81CCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCCCCCCCEEEEEEEEECC-----160 (303)
Q d20180625_281MGAWLGKQKFSLMIVEKHAALFLDEIVVAYDDQSTFDVVFHAILFTVTIMSKLLAPPIVPLMSSVAACDYTVIGH-----160 (303)
T 3FPZ_B81GGSWLGGQLFSAMVMRKPAHLFLQELEIPYEDEGDYVVVKHAALFISTVLSKVLQLPNVKLFNATCVEDLVTRPPTEKGE160 (303)
T ss_pred81CCCCCCCCCCCHHHHCCHHHHHHHHHCCCCCCCCCEEEECCHHHHHHHHHHHHHHHCCCEEECCEEEEEEEEECCCCCCC160 (303)
T ss_dssp81TTTTCCGGGCCCEEEETTTHHHHHHTTCCCEECSSEEEESCHHHHHHHHHHHHHTSTTEEEETTEEEEEEEECSCCUUUU160 (303)
Q ss_pred161-EEEEEEECCCCCCCCCCCCCCCCC---------------CCEEEEEEECCCCCCCCCCCCEEEEECCCCCCCCCCCCCC240 (303)
Q d20180625_2161-RVGGMVTNEALVAKFNATQGNMDP---------------PVMRRKIAWSSMNHDGPPGDTGVVNLGSIGMDDHVFGMKA240 (303)
T 3FPZ_B161VTVAGVVTNWTLVTQAHGTQCAMDPNVIELAGYKNDGTRDLSQKHGVILSTTGHDGPFGAFCAKRIVDIDQNQKLGGMKG240 (303)
T ss_pred161CEEEEEEECCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCEEEECCCCCCCCHHEEEEEECCCCCCCCCCCCCC240 (303)
T ss_dssp161CCEEEEEEEEHHHHTCCSSCSCCCCEEEEESCBCTTSSBCTTSCCCEEEECCCSSSSSCSHHHHHHHHHCTTCCCCCCCC240 (303)
Q ss_pred241CCCCCCCCCEECCCCC--CCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCC303 (303)
Q d20180625_2241SHMNEAECASVRPVRE--VCVGMIVIGMEKKEPEIGPNVGPTFYAMMISGPIASQYYLKAWGL303 (303)
T 3FPZ_B241LDMNHAEHDVVIHSGAYAGVDNMYFAGMEVAELDGLNRMGPTFGAMALSGVHAAEQILKHFAA303 (303)
T ss_pred241CCHHHHHHHHHHHCCCCCCCCCEEECCHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHCC303 (303)
T ss_dssp241BCHHHHHHHHHHHCEECTTSTTEEECTHHHHHHHTCCBCCSCCHHHHHHHHHHHHHHHHHHHC303 (303)


No 4
> 2GJC_A    Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A*     Alignment in PIR format
MAC score = 102.11	Identity = 0.37

Download partial structureDownload full-length structure
Q ss_pred1CCC---------CCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHCC-CCCCCEEEEEEECCCCC80 (303)
Q d20180625_21YDL---------QAFHFDPNKESIVSMEMCMRYPTDWITYAECDVVVYAYGSAGLSAAYENS-FNPNTQVDIIEQSREPG80 (303)
T 2GJC_A1HCLSDIVKKEDWSDFKFAPIRESTVSRAMTSRYFKDLDKFAVSDVIIVGAGSSGLSAAYVIAKNRPDLKVCIIESSVAPG80 (303)
T ss_pred1HHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCHHHHHHHHHHHHCCCCCCEEEEECCCCCC80 (303)
T ss_dssp180 (303)
Q ss_pred81CCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCCCCCCCEEEEEEEEECC-----160 (303)
Q d20180625_281MGAWLGKQKFSLMIVEKHAALFLDEIVVAYDDQSTFDVVFHAILFTVTIMSKLLAPPIVPLMSSVAACDYTVIGH-----160 (303)
T 2GJC_A81GGSWLGGQLFSAMVMRKPAHLFLQELEIPYEDEGDYVVVKHAALFISTVLSKVLQLPNVKLFNATCVEDLVTRPPTEKGE160 (303)
T ss_pred81CCEEECCCCCCHHHCCHHHHHHHHHCCCCEECCCCEEEECCHHHHHHHHHHHHHHCCCCEEEECCCHHHEEECCCCCCCC160 (303)
T ss_dssp81160 (303)
Q ss_pred161-EEEEEEECCCCCCCCC-------CCCCCCC--------CCCEEEEEEECCCCCCCCCCCCEEEEECCCCCCCCCCCCCC240 (303)
Q d20180625_2161-RVGGMVTNEALVAKFN-------ATQGNMD--------PPVMRRKIAWSSMNHDGPPGDTGVVNLGSIGMDDHVFGMKA240 (303)
T 2GJC_A161VTVAGVVTNWTLVTQAHGTQCCMDPNVIELAGYKNDGTRDLSQKHGVILSTTGHDGPFGAFCAKRIVDIDQNQKLGGMKG240 (303)
T ss_pred161CEEEEEEEECCCCCCCCCCCCCCCCCEEEEEECCCCCCEEEEECCEEEEECCCCCCCHHHHHHHHHCCCCCCCCCCCCCC240 (303)
T ss_dssp161240 (303)
Q ss_pred241CCCCCCCCCEECCCCCC--CCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCC303 (303)
Q d20180625_2241SHMNEAECASVRPVREV--CVGMIVIGMEKKEPEIGPNVGPTFYAMMISGPIASQYYLKAWGL303 (303)
T 2GJC_A241LDMNHAEHDVVIHSGAYAGVDNMYFAGMEVAELDGLNRMGPTFGAMALSGVHAAEQILKHFAA303 (303)
T ss_pred241CCCCCCCEEEEECCCEEECCCCEEEECEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHC303 (303)
T ss_dssp241303 (303)


No 5
> 2GMJ_A        Alignment in PIR format
MAC score = 64.33	Identity = 0.15

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCHHHHHHHHHHHHH--HHHHHHHCCCEEEECCCCCCHHHHHHCC-----CCCCCEEEEEEECCCCCCCC80 (403)
Q d20180625_21YDLQAFHFDPNKESIVSMEMCMRYP--TDWITYAECDVVVYAYGSAGLSAAYENS-----FNPNTQVDIIEQSREPGMGA80 (403)
T 2GMJ_A1KVPRITTHYTIYPRD----QDKRWEGVNMERFAEEADVVIVGAGPAGLSAATRLKQLAAQHEKDLRVCLVEKAAHIGAHT80 (403)
T ss_pred1CCCEEECCCCCCCCC----CCCCCCCCCCCCCCCCCCEEEECCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCC80 (403)
T ss_dssp1CSCCCCCCTTTSCTT----SSGGGTTCCCCCCEEECSEEEECCSHHHHHHHHHHHHHHHHTTCCCCEEEEESSSSTTTTC80 (403)
Q ss_pred81CCCCCCCHHHHHHHHHHHHHHHHC----CCC-------------CCCC---C-----CEEEEEHHHHHHHHHHHHHCCCC160 (403)
Q d20180625_281WLGKQKFSLMIVEKHAALFLDEIV----VAY-------------DDQS---T-----FDVVFHAILFTVTIMSKLLAPPI160 (403)
T 2GMJ_A81LSGACLDPR-AFEELFPD-WKEKGAPLNTPVTEDRFGILTEKYRIPVPILPGLPMNNHGNYVVRLGHLVSWMGEQAEALG160 (403)
T ss_pred81CCCCCCCHH-HHHHHHHC-CCCCCCCCCCEEEEEEEEEECCCCEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHHCC160 (403)
T ss_dssp81CCCCEECTH-HHHHHCTT-HHHHTCCCCEECCEECCEEECSSCEEECCCCSSSTTCCTTCEECCHHHHHHHHHHHHHHHT160 (403)
Q ss_pred161CCCCCCEEEEEEEEEC-CEEEEEEECCCCCCCCC----CCC-----------CC--------------------CC--CC240 (403)
Q d20180625_2161VPLMSSVAACDYTVIG-HRVGGMVTNEALVAKFN----ATQ-----------GN--------------------MD--PP240 (403)
T 2GMJ_A161VEVYPGYAAAEILFHEDGSVKGIATNDVGIQKDGAPKTTFERGLELHAKVTIFAEGCHGHLAKQLYKKFDLRANCEPQTY240 (403)
T ss_pred161CEEECCEEEEEEEECCCCCEEEEEECCCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCCHHHHHHCCCCCCCCCCCCCEE240 (403)
T ss_dssp161CEEEETCCEEEEEECSSSSEEEEEECCEEECTTSCEEEEEECCCEEECSEEEECCCTTCHHHHHHHHHTTTTTTSCCCCE240 (403)
Q ss_pred241CEEEEEEECCCCCCCCCCCCEEEEECCCC--------------------------CCCCCCCCCCC-------CCCCCCC320 (403)
Q d20180625_2241VMRRKIAWSSMNHDGPPGDTGVVNLGSIG--------------------------MDDHVFGMKAS-------HMNEAEC320 (403)
T 2GMJ_A241GIGLKELWVIDEKKWKPGRVDHTVGWPLDRHTYGGSFLYHLNEGEPLLALGFVVGLDYQNPYLSPFREFQRWKHHPSIKP320 (403)
T ss_pred241EEEEEEEEECCCCCCCCCEEEEEECCCCCCCCCCCEEEEEECCCCCEEEEEEEECCCCCCCCCCHHHHHHHHHHCCCHHH320 (403)
T ss_dssp241EEEEEEEEECCGGGCCTTEEEEEEETTSCTTSCEEEEEEECCSSSCEEEEEEEEETTCCCTTCCHHHHHHHHTTSTTTHH320 (403)
Q ss_pred321CEECC-CCCC-----CC-------CEEEEEEECCCCCC---CCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCC------400 (403)
Q d20180625_2321ASVRP-VREV-----CV-------GMIVIGMEKKEPEI---GPNVGPTFYAMMISGPIASQYYLKAWGLPNAIG------400 (403)
T 2GMJ_A321TLEGGKRIAYGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGTLAAESIFNQLTSENLQSKTIGLH400 (403)
T ss_pred321HCCCCEEEEECCEEEECCCCCCCCCCCCCCEEEEECCHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHH400 (403)
T ss_dssp321HHTTCEEEEEEEEEEECCGGGGCCCCEETTEEECTTTTCCCBTTTTBCHHHHHHHHHHHHHHHHHHHSSCCCCCSSSSCC400 (403)
Q ss_pred401CCC403 (403)
Q d20180625_2401LTL403 (403)
T 2GMJ_A401VTE403 (403)
T ss_pred401HHH403 (403)
T ss_dssp401CTH403 (403)


No 6
> 3J02_K        Alignment in PIR format
MAC score = 61.15	Identity = 0.08

Download partial structureDownload full-length structure
Q ss_pred1CCCCC-----------CCCCCCCHHHHHHHHHHHHHHHHHHHHC-------CCEEEEC--CCCC-------CHHHHHHC-80 (375)
Q d20180625_21YDLQA-----------FHFDPNKESIVSMEMCMRYPTDWITYAE-------CDVVVYA--YGSA-------GLSAAYEN-80 (375)
T 3J02_K1CEVGAQDKEILTKIAMTSITGKGAEKAKEKLAEIIVEAVSAVVDDEGKVDKDLIKIEKKSGASIDDTELIKGVLVDKERV80 (375)
T ss_pred1CCCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEECCCCCCCCCEEEEEEEECCCCC80 (375)
T ss_dssp1EECCTTCHHHHHHHHHHHHTTSGGGGGHHHHHHHHHHHHHHHHTTTTCCCGGGEEEEECCBSCGGGCEEESEEEECCCCS80 (375)
Q ss_pred81-----CCCCCCEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCC-------CCC-------CCCCEEEEEHH160 (375)
Q d20180625_281-----SFNPNTQVDIIEQSREPGMGAWLGKQKFSLMIVEKHAALFLDEIVVA-------YDD-------QSTFDVVFHAI160 (375)
T 3J02_K81SAQMPKKVTDAKIALLNCAIEET----------ASEM-LKDMVAEIKASGANVLFCQKGIDDLAQHYLAKEGIVAARRVK160 (375)
T ss_pred81CCCCCCCCCCCEEEEECCCCCHH----------HHHH-HHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCEEEEECC160 (375)
T ss_dssp81CTTSCSEEEEEEEEEECSCBCCS----------SHHH-HHHHHHHHHHHTCCEEEESSCBCHHHHHHHHHTTCEEECSCC160 (375)
Q ss_pred161HHHHHHHHHHHCCCCCC--------CCCCEEEEEEEEECCEEEEEEECCC-----CCCC-CCCCCCC--C----------240 (375)
Q d20180625_2161LFTVTIMSKLLAPPIVP--------LMSSVAACDYTVIGHRVGGMVTNEA-----LVAK-FNATQGN--M----------240 (375)
T 3J02_K161KSDMEKLAKATGANVITNIKDLSAQDLGDAGLVEERKISGDSMIFVEECKHPKAVTMLIRGTTEHVIEEVARAVDAAVGV240 (375)
T ss_pred161HHHHHHHHHHHCCCCCCCCCCCCHHHCCCCCEEEEEEECCEEEEEEECCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHH240 (375)
T ss_dssp161HHHHHHHHHHHCCCCBSSGGGCCGGGCEEEEEEEEEEETTEEEEEEECCSSCSCEEEEECBSSHHHHHHHHHHHHHHHHH240 (375)
Q ss_pred241-CCCCEEEEEEECCCCCCCCCCCCEEEEECCC-C-CC-CC--------------------CCCCCCCC-CCCCCCCEECC320 (375)
Q d20180625_2241-DPPVMRRKIAWSSMNHDGPPGDTGVVNLGSI-G-MD-DH--------------------VFGMKASH-MNEAECASVRP320 (375)
T 3J02_K241VGCTIEDGRIVSGGGSTE----VELSMKLREYAEGISGREQLAVRAFADALEVIPRTLAENAGLDAIEILVKVRAAHASN320 (375)
T ss_pred241HHHHHCCCCEEECCCHHH----HHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCC320 (375)
T ss_dssp241HHHHHHSCEEEETTTHHH----HHHHHHHHHHHHHHCTTHHHHHHHHHHHTTHHHHHHHHHHTCCHHHHHHHHHHHHHHH320 (375)
Q ss_pred321CCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCC375 (375)
Q d20180625_2321VREVCVGMIVIGMEKKEPEIGPNVGPTFYAMMISGPIASQYYLKAWGLPNAIGLT375 (375)
T 3J02_K321--GNKCAGLNVFTGAVEDMCENGVVEPLRVKTQAIQSAAESTEMLLRIDDVIAAE375 (375)
T ss_pred321--CCCEEEEEECCCCEEEHHHCCCEECHHHHHHHHHHHHHHHHHHHHHHHHHCCC375 (375)
T ss_dssp321--CSSSCCEETTTTEECCTTTTTCEEEHHHHHHHHHHHHHHHHHHHHEEEEEECC375 (375)


No 7
> 1QO8_A    Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1     Alignment in PIR format
MAC score = 60.98	Identity = 0.13

Download partial structureDownload full-length structure
Q ss_pred1CCC--CCCC---------CCCCCHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHCCCCCCCEEEEEEECCCC80 (491)
Q d20180625_21YDL--QAFH---------FDPNKESIVSMEMCMRYPTDWITYAECDVVVYAYGSAGLSAAYENSFNPNTQVDIIEQSREP80 (491)
T 1QO8_A1HSFDIKPMPFSDAKKKKSWDDGWDQDK----IQKAIA-AGPSETTQVLVVGAGSAGFNASLAAKK-AGANVILVDKAPFS80 (491)
T ss_pred1CCCCCCCCCCCCCCHHHHHHHCCCCCC----CCHHCC-CCCCCCCCEEEECCCHHHHHHHHHHHH-CCCCEEEEECCCCC80 (491)
T ss_dssp1CCCCCCCCTTTTSCCCCCSCCCCCHHH----HHHHHH-TCCSEEEEEEEECCSHHHHHHHHHHHH-HTCCEEEECSSSSS80 (491)
Q ss_pred81CCCCCCC--------------------------------CCCCH---HHHHHHHHHHHHH---HHCCC---CCCCC--CC160 (491)
Q d20180625_281GMGAWLG--------------------------------KQKFS---LMIVEKHAALFLD---EIVVA---YDDQS--TF160 (491)
T 1QO8_A81GGNSMISAGGMNAVGTKQQTAHGVEDKVEWFIEDAMKGGRQQNDIKLVTILAEQSADGVQWLESLGANLDDLKRSGGARV160 (491)
T ss_pred81CCCHHHCCCCEEECCCHHHHHHCCCCCHHHHHHHHHHHCCCCCCHHHHHHHHHCCHHHHHHHHHCCCCCCCCCCCCCCCC160 (491)
T ss_dssp81CTTGGGCCSCEECSSCHHHHHTTCCCCHHHHHHHHHHHTTTCSCHHHHHHHHHHHHHHHHHHHHTTCCCCEEECCTTCSS160 (491)
Q ss_pred161EEEEE------HHHHHHHHHHHHHCCCCCCCCCCEEEEEEEEEC-CEEEEEEECCC-----------CCCCCC-------240 (491)
Q d20180625_2161DVVFH------AILFTVTIMSKLLAPPIVPLMSSVAACDYTVIG-HRVGGMVTNEA-----------LVAKFN-------240 (491)
T 1QO8_A161DRTHRPHGGKSSGPEIIDTLRKAAKEQGIDTRLNSRVVKLVVNDDHSVVGAVVHGKHTGYYMIGAKSVVLATGGYGMNKE240 (491)
T ss_pred161CCEECCCCCCCCHHHHHHHHHHHHHHCCCEEEECCEEEEEEECCCCCEEEEEEEECCCCEEEEECCEEEEECCCCHHCHH240 (491)
T ss_dssp161CCEEECSSSSCHHHHHHHHHHHHHHHTTCCEECSEEEEEEEECTTSBEEEEEEEETTTEEEEEEEEEEEECCCCCTTCHH240 (491)
Q ss_pred241----------CCCCC-------------------CC-CCCEEEEEEECCCCCCCCCCC-----CEEEEECCCC----C--320 (491)
Q d20180625_2241----------ATQGN-------------------MD-PPVMRRKIAWSSMNHDGPPGD-----TGVVNLGSIG----M--320 (491)
T 1QO8_A241MIAYYRPTMKDMTSSNNITATGDGVLMAKEIGASMTDIDWVQAHPTVG-KDSRILISETVRGVGAVMVNKDGNRFISELT320 (491)
T ss_pred241HHHHHCCCCCCCCCCCCCCCCHHHHHHHHHCCCEEECCCCCEECCCCC-CCCCCCCCCCCCCCCEEEECCCCCCCCCCCC320 (491)
T ss_dssp241HHHHHCGGGTTCEECSCTTCSCHHHHHHHHTTBCEESTTCEEEEEEEE-SSSCSBCCTHHHHTTCEEECTTSCCCSCTTS320 (491)
Q ss_pred321-CC------------------------C---------------CC---------CCCCCCCCCCC---------------400 (491)
Q d20180625_2321-DD------------------------H---------------VF---------GMKASHMNEAE---------------400 (491)
T 1QO8_A321TRDKASDAILKQPGQFAWIIFDNQLYKKAKMVRGYDHLEMLYKGDTVEQLAKSTGMKVADLAKTVSDYNGYVASGKDTAF400 (491)
T ss_pred321CHHHHHHHHHHCCCCCEEEEECHHHHHHHHHHHHHHHCCCEEEECCHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCCC400 (491)
T ss_dssp321CHHHHHHHHHTSGGGCEEEEEEHHHHHHCHHHHHHHHTTCCEEESSHHHHHHHTTCCHHHHHHHHHHHHHHHHHSCCTTT400 (491)
Q ss_pred401-----CCEECC------------------------------CCCCCCCEEEEEEECCCCCCCC-CCCHHHHHHHHHHHHH480 (491)
Q d20180625_2401-----CASVRP------------------------------VREVCVGMIVIGMEKKEPEIGP-NVGPTFYAMMISGPIA480 (491)
T 1QO8_A401GRADMPLNMTQSPYYAVKVAPGIHHTMGGVAINTTASVLDLQSKPIDGLFAAGEVTGGVHGYNRLGGNAIADTVVFGRIA480 (491)
T ss_pred401CCCCCCCCCCCCCEEEEEEEEEEEEECCCEEECCCCEEECCCCCEECCCEECCCCCCCCCCCCCCCHHHHHHHHHHHHHH480 (491)
T ss_dssp401CCSCCCCCSCSSSEEEEEEEEEEEEECCEECBCTTCEEEBTTSCEEEEEEECSTTBCSSSTTCCCTTHHHHHHHHHHHHH480 (491)
Q ss_pred481HHHHHHHCCCC491 (491)
Q d20180625_2481SQYYLKAWGLP491 (491)
T 1QO8_A481GDNAAKHALDK491 (491)
T ss_pred481HHHHHHHHHCC491 (491)
T ss_dssp481HHHHHHHHCCU491 (491)


No 8
> 3CIR_A        Alignment in PIR format
MAC score = 60.4	Identity = 0.11

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHCCCCCCCEEEEEEECCCCCCC-------CCC80 (433)
Q d20180625_21LQAFHFDPNKESIVSMEMCMRYPTDWITYAECDVVVYAYGSAGLSAAYENSFNPNTQVDIIEQSREPGMG-------AWL80 (433)
T 3CIR_A1MQTFQADLAIVGA-GGAGLRAAIAAAQANPNAKIALISKVYPMRSHTV-----AAEGGSAAVAQ-DHDSFEYHFHDTVAG80 (433)
T ss_pred1CCEEEEEEEEECC-CHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCHH-----HCCCCEEEEEC-CCCCHHHHHHHHHHH80 (433)
T ss_dssp1CEEEECSEEEECC-SHHHHHHHHHHHHHCTTCCEEEEESSCGGGSGGG-----GCCSCEECCCS-TTCCHHHHHHHHHHH80 (433)
Q ss_pred81CCCCCHHH---HHHHHHHHHHHHHC---CCCCCCC------------CCEEEEEH----HHHHHHHHHHHH-CCCCCCCC160 (433)
Q d20180625_281GKQKFSLM---IVEKHAALFLDEIV---VAYDDQS------------TFDVVFHA----ILFTVTIMSKLL-APPIVPLM160 (433)
T 3CIR_A81GDWLCEQDVVDYFVHHCPTEMTQLELWGCPWSRRPDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLQFPQIQRF160 (433)
T ss_pred81CCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEECCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCEE160 (433)
T ss_dssp81TTTCSCHHHHHHHHHHHHHHHHHHHTTTCCCCBCTTSSBCEECCTTCSSCCEECSTTCHHHHHHHHHHHHHTTCTTEEEE160 (433)
Q ss_pred161CCEEEEEEEEECCEEEEEEECCCC-----CCCCC-------------CCCCC---CC----CC-------CEE-EEEEEC240 (433)
Q d20180625_2161SSVAACDYTVIGHRVGGMVTNEAL-----VAKFN-------------ATQGN---MD----PP-------VMR-RKIAWS240 (433)
T 3CIR_A161DEHFVLDILVDDGHVRGLVAMNMMEGTLVQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMALSHGVPLRDMEFVQYH240 (433)
T ss_pred161CCEEEEEEEEECCEEEEEEEEECCCCCEEEEECCEEEEECCCCCHHHCCCCCCCCCCHHHHHHHHHCCCCCCCCCEEEEC240 (433)
T ss_dssp161ETEEEEEEEECSSBEEEEEEEETTTTEEEEEECSCEEECCCCCGGGSSSBCSCTTCSCHHHHHHHTTTCCEETTTCEEEE240 (433)
Q ss_pred241CCCCCCCCCCCEEEEECCCC-------------------------------------------CCCC----CC-------320 (433)
Q d20180625_2241SMNHDGPPGDTGVVNLGSIG-------------------------------------------MDDH----VF-------320 (433)
T 3CIR_A241PAGLPG-SGILMTEGCRGEGGILVNKNGYRYLQDYGMGPETPLGEPKNKYMELGPRDKVSQAFWHEWRKGNTISTPRGDV320 (433)
T ss_pred241CCCCCC-CCCEECCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCE320 (433)
T ss_dssp241SCBCTT-TCCBCCSHHHHTTCCUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUCHHHHHHHHTTTTTTCSCCCSCCUU320 (433)
Q ss_pred321-CCCCCCC-----CC-CCC--------CEECCCCCC-----------------------CCCEEEEEEECCCCCCC-CCC400 (433)
Q d20180625_2321-GMKASHM-----NE-AEC--------ASVRPVREV-----------------------CVGMIVIGMEKKEPEIG-PNV400 (433)
T 3CIR_A321VYLDLRHLGEKKLHERLPFICELAKAYVGVDPVKEPIPVRPTAHYTMGGIETDQNCETRIKGLFAVGECSSVGLHGANRL400 (433)
T ss_pred321EEEECCCCCHHHHHHHCCHHHHHHHHHCCCCCCCCCCCCCCCCCEECCCEEECCCEEEECCCEEEEEEECCCCCCCCCHH400 (433)
T ss_dssp321UCCCCGGGCHHHHHHHCHHHHHHHHHHHSCCTTTSCCCCCCEEEEECCEEECCTTSBCSSBTEEECSTTEECSCSTTSCC400 (433)
Q ss_pred401-CHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCC433 (433)
Q d20180625_2401-GPTFYAMMISGPIASQYYLKAWGLPNAIGLTL433 (433)
T 3CIR_A401GSNSLAELVVFGRLAGEQATERAATAG--NGNE433 (433)
T ss_pred401HHHHHHHHHHHHHHHHHHHHHHHHCCC--CCCC433 (433)
T ss_dssp401TTHHHHHHHHHHHHHHHHHHHHHTTCC--CCCH433 (433)


No 9
> 1Q3R_A        Alignment in PIR format
MAC score = 60.36	Identity = 0.11

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCCCHH-------------------HHHHHHHHHHHHHHHHHHC---------CCEEEECCCCCC---HHHH80 (395)
Q d20180625_21YDLQAFHFDPNKES-------------------IVSMEMCMRYPTDWITYAE---------CDVVVYAYGSAG---LSAA80 (395)
T 1Q3R_A1DEI-AIRVDPDDEETLLKIAATSITGKNAESHKELLAKLAVEAVKQVAEKKDGKYVVDLDNIKFEKKAGEGVEESELVRG80 (395)
T ss_pred1HHH-CCCCCCCCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHEEEEEECCCCCCCEEEEEE80 (395)
T ss_dssp1HHH-CEECCTTCHHHHHHHHHHHHTTSGGGGGHHHHHHHHHHHHHHHCEESSSCEECCGGGEEEEEEEBSCGGGCEEESS80 (395)
Q ss_pred81HHC----------CCCCCCEEEEEEECCCCCCCC------CCCC-CCC-HHHHHHHHHHH---HHHHHCCC-------CC160 (395)
Q d20180625_281YEN----------SFNPNTQVDIIEQSREPGMGA------WLGK-QKF-SLMIVEKHAAL---FLDEIVVA-------YD160 (395)
T 1Q3R_A81VVIDKEVVHPRMPKRVENAKIALINEALEVKKTETDAKINITSPDQLMSFLEQEEKMLKDMVDHIAQTGANVVFVQKGID160 (395)
T ss_pred81EEEECCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCEEEECCHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCC160 (395)
T ss_dssp81EEESCCCSSTTSCSEETTCEEEEECSCBSCCCCSSCCCEEECSHHHHHHHHHHHHHHHHHHHHHHHHHTCCEEEESSCBC160 (395)
Q ss_pred161-------CCCCCEEEEEHHHHHHHHHHHHHCCCCCCC---------CCCEEEEEEEEECCEEEEEEECC-----CCCCCC240 (395)
Q d20180625_2161-------DQSTFDVVFHAILFTVTIMSKLLAPPIVPL---------MSSVAACDYTVIGHRVGGMVTNE-----ALVAKF240 (395)
T 1Q3R_A161DLAQHYLAKYGIMAVRRVKKSDMEKLAKATGAKIVTNVKDLTPEDLGYAEVVEERKLAGENMIFVEGCKNPKAVTILIRG240 (395)
T ss_pred161HHHHHHHHHCCCEEEEECCHHHHHHHHHHHCCEECCCCHHCCHHHCEEEEEEEEEEECCCCEEEEECCCCCCEEEEEECC240 (395)
T ss_dssp161HHHHHHHHHTTCEEECSCCHHHHHHHHHHHCCCEESSGGGCCGGGCEECSEEEEEEETTEEEEEEECCSSCSSEEEEEEE240 (395)
Q ss_pred241CCCCCC--CC----------CCCEEEEEEECCCCCCCCCCCCEEEEECCCC--CCCC---------------------CC320 (395)
Q d20180625_2241NATQGN--MD----------PPVMRRKIAWSSMNHDGPPGDTGVVNLGSIG--MDDH---------------------VF320 (395)
T 1Q3R_A241GTEHVIDEVERALEDAVKVVKDVMEDGAVLPAGGAPE---IELAIRLDEYAKQVGGKEALAIENFADALKIIPKTLAENA320 (395)
T ss_pred241CCHHHHHHHHHHHHHHHHHHHHHHHCCCEECCCCHHH---HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHC320 (395)
T ss_dssp241SSHHHHHHHHHHHHHHHHHHHHHHHCCEEEECTTHHH---HHHHHHHHHHHHTTCHHHHHHHHHHHHHTTHHHHHHHHHH320 (395)
Q ss_pred321CCCCC-CCCCCCCCEECCCCCCCCCEEEEEEECCCCCCC-CCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCC395 (395)
Q d20180625_2321GMKAS-HMNEAECASVRPVREVCVGMIVIGMEKKEPEIG-PNVGPTFYAMMISGPIASQYYLKAWGLPNAIGLTL395 (395)
T 1Q3R_A321GLDTVEMLVKVISEHKN--RG--LGIGIDVFEGKPADMLEKGIIEPLRVKKQAIKSASEAAIMILRIDDVIAAKA395 (395)
T ss_pred321CCCHHHHHHHHHHHHHC--CC--CEEEEECCCCCCCCHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC395 (395)
T ss_dssp321TCCHHHHHHHHHHHHHH--HC--TTEEEETTTTEEEEHHHHTCEEEHHHHHHHHHHHHHHHHHHHTCCEEEECCC395 (395)


No 10
> 3P4R_A        Alignment in PIR format
MAC score = 59.49	Identity = 0.1

Download partial structureDownload full-length structure
Q ss_pred1CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHCCCCCCCEEEEEEECCCCCC--C----CCCC80 (431)
Q d20180625_21LQAFHFDPNKESIVSMEMCMRYPTDWITYAECDVVVYAYGSAGLSAAYENSFNPNTQVDIIEQSREPGM--G----AWLG80 (431)
T 3P4R_A1MQTFQADLAIV-GAGGAGLRAAIAAAQANPNAKIALISKVYPMRSHT-----VAAEGGSAAVAQDHDSFEYHFHDTVAGG80 (431)
T ss_pred1CCEEECCEEEE-CCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCH-----HHHCCCEEEECCCCCCHHHHHHHHHHHC80 (431)
T ss_dssp1CEEEECSEEEE-CCSHHHHHHHHHHHHHCTTCCEEEEESSCGGGSGG-----GGCCSCEECCCSTTCCHHHHHHHHHHHT80 (431)
Q ss_pred81CCCCHHH---HHHHHHHHHHH---HHCCCCCCCC------------CCEEEEE----HHHHHHHHHHHHH-CCCCCCCCC160 (431)
Q d20180625_281KQKFSLM---IVEKHAALFLD---EIVVAYDDQS------------TFDVVFH----AILFTVTIMSKLL-APPIVPLMS160 (431)
T 3P4R_A81DWLCEQDVVDYFVHHCPTEMTQLELWGCPWSRRPDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLQFPQIQRFD160 (431)
T ss_pred81CCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEECCCCCCCCCCEEEEECCCHHHHHHHHHHHHHHHCCCCEEEE160 (431)
T ss_dssp81TTCSCHHHHHHHHHHHHHHHHHHHHTTCCCCBCTTSSBCEECCTTCSSCCEECSTTCHHHHHHHHHHHHHTTCTTEEEEE160 (431)
Q ss_pred161CEEEEEEEEECCEEEEEEECCCC-----CCCCC-------------CCCCC---CC----------------CCCEEEEE240 (431)
Q d20180625_2161SVAACDYTVIGHRVGGMVTNEAL-----VAKFN-------------ATQGN---MD----------------PPVMRRKI240 (431)
T 3P4R_A161EHFVLDILVDDGHVRGLVAMNMMEGTLVQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMALSHGVPLRDMEFVQYHP240 (431)
T ss_pred161EEEEEEEEEECCEEEEEEEEECCCCCEEEEECCEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEEECC240 (431)
T ss_dssp161SEEEEEEEEETTEEEEEEEEETTTTEEEEEECSSEEECCCCCGGGSSSBSSCTTCSCHHHHHHHTTTCCEECTTCEEEEE240 (431)
Q ss_pred241EECCCCCCCCCC----CCEEEEECC--CC-----CCCCC----CCC------C--------------------------C320 (431)
Q d20180625_2241AWSSMNHDGPPG----DTGVVNLGS--IG-----MDDHV----FGM------K--------------------------A320 (431)
T 3P4R_A241TGLPGSGILMTEGCRGEGGILVNKNGYRYLQDYGMGPETPLGEPKNKYMELGPRDKVSQAFWHEWRKGNTISTPRGDVVY320 (431)
T ss_pred241CCCCCCCEEECCCCCCCCCEEECCCCCCHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCEEE320 (431)
T ss_dssp241EECTTTCCBCCTHHHHTTCEEECTTCCBGGGGGTTCSCCCSSCCCTTSGGGSCHHHHHHHHHHHHHTTCSEEETTEEEEE320 (431)
Q ss_pred321CCCCCC--------CCC---------EECCCC---CC--------------------CCCEEEEEEECCCCCCC-CCCC-400 (431)
Q d20180625_2321SHMNEA--------ECA---------SVRPVR---EV--------------------CVGMIVIGMEKKEPEIG-PNVG-400 (431)
T 3P4R_A321LDLRHLGEKKLHERLPFICELAKAYVGVDPVKEPIPVRPTAHYTMGGIETDQNCETRIKGLFAVGECSSVGLHGANRLGS400 (431)
T ss_pred321EECCCCCHHHHHHHCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCEEEEECCCCCCCCCCCCCHH400 (431)
T ss_dssp321EECGGGCHHHHHHHCHHHHHHHHHHHCCCTTTSCEEEEEEEEEECCEEECCTTSBCSSBTEEECGGGEECSSSTTSCCTT400 (431)
Q ss_pred401HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCC431 (431)
Q d20180625_2401PTFYAMMISGPIASQYYLKAWGLPNAIGLTL431 (431)
T 3P4R_A401NSLAELVVFGRLAGEQATERAATA---GNGN431 (431)
T ss_pred401HHHHHHHHHHHHHHHHHHHHHCCC---CCCC431 (431)
T ss_dssp401HHHHHHHHHHHHHHHHHHHHHHHC---CCCC431 (431)