TreeThreader - Results

  Job information

Job ID: d20180621
#Proteins: 4
Protein ID: d20180621_1
Fasta ID: seq1
Submission time: 2018-06-21 10:54:02 +0800
Finished time: 2018-06-22 22:26:12 +0800
Identical Job(s): NULL

  Alignments

1
50
100
130

  Build multi-template model (choose up to 5 templates)

Building multi-template model...

  Top 10 hits

Query:
Job ID  : d20180621_1
Length : 130
Sequence: GRHCPKIVTFFQGWMYFWVNLQRNWHDSVTACQMVRRQTVRLKTAENWNFLQLQFSRSNRFSWMGLIKLNQEGTNQWCDP QMLSPTFQRYWNSGEPSNSGNEDCAEESGSGVKCNTCLVDNSWINAWPAA

No Hit MAC Score Identity Cols Query HMM Template HMM

  Pairwise Query-Template Alignment