TreeThreader - Results

  Job information

Job ID: d20180609
#Proteins: 4
Protein ID: d20180609_4
Fasta ID: seq4
Submission time: 2018-06-09 10:54:03 +0800
Finished time: 2018-06-10 01:06:02 +0800
Identical Job(s): NULL

  Alignments

1
50
100
150
200
240

  Build multi-template model (choose up to 5 templates)

Building multi-template model...

  Top 10 hits

Query:
Job ID  : d20180609_4
Length : 240
Sequence: TPIRVVPWFTFRHEKKDEQVCHIYVNCMHTDIASYVCEAGFDAAHAVLDEIWHALTDEVLDGIDVTVWKGDIAHKYMKDT VVERVHRIVLEGMGLIVTHSGQFSKIIPKLMGTAYPLADREADTKERLWVFAPGHPIVEGKNPCIELEREEMYGEFFDIM EPDEEIFISWFCGVEVIRSKCTFYRGKGKIFESRPGHMTYIWYHHPDLLKVHVAVVNWAAFVNRGLQVHGNVCPLQPMGA

No Hit MAC Score Identity Cols Query HMM Template HMM

  Pairwise Query-Template Alignment