TreeThreader - Results

  Job information

Job ID: d20180526
#Proteins: 4
Protein ID: d20180526_1
Fasta ID: seq1
Submission time: 2018-05-26 10:54:03 +0800
Finished time: 2018-05-27 02:54:14 +0800
Identical Job(s): NULL

  Alignments

1
50
100
128

  Build multi-template model (choose up to 5 templates)

Building multi-template model...

  Top 10 hits

Query:
Job ID  : d20180526_1
Length : 128
Sequence: GMSGSSGFGIISMAIRFDRRAFFPQITPKMCASYWCRRYMLPQPVYEPGQRTIDRMFCSHNRTAEQNHQSTLWEKSKWTA EQEAVIVQLTSQGLPEMSLGEHSPSLNKPTREKPDQDPGGSEPINGSG

No Hit MAC Score Identity Cols Query HMM Template HMM

  Pairwise Query-Template Alignment