TreeThreader - Results

  Job information

Job ID: d20180412
#Proteins: 4
Protein ID: d20180412_1
Fasta ID: seq1
Submission time: 2018-04-12 10:54:02 +0800
Finished time: 2018-04-13 01:30:04 +0800
Identical Job(s): NULL

  Alignments

1
50
100
150
200
250
300
350
380

  Build multi-template model (choose up to 5 templates)

Building multi-template model...

  Top 10 hits

Query:
Job ID  : d20180412_1
Length : 380
Sequence: ASVSVLLVNKDNKFDPEDAGSTPLYQQDTNKSPTAIENGPYDYTRSGNPTADALESLLATLDKAEREFCDTTGMAAVTAV CGASERGEEIVHGKDVYGGSDRLLSQVVPPSGVVVKVVETTKPDEQWAAEGPQTCLVWLESVTNPRQQISDIRKIQEMAH AQGALVDVYNKNMKPVLSCPLELWRIIVQFSATKEIEPHSDVMLQCQAVKGEKQAKEVYFLFNSEDSGLAPFECWLCRRI AITMALRIEKQHKNARLIADYWSSHPRKCKVSYAGLCDHPGHHLHFPQPKHAGSVYSMITGSVMLGKHLVETTPAFSIAQ SIGSCKTIISMPKFMRHHSIPFEVREGRFRKEDLVRHSQGYVDCDGLMSDLDIAFKTLFL

No Hit MAC Score Identity Cols Query HMM Template HMM

  Pairwise Query-Template Alignment