COLORS - Results    Job ID: 43   Date: 2015-08-22 12:52:41

Query:
Job name: 12346
Length : 145
Neff : 1000.000000
Sequence: LFKLGAENIFLGRKAATKEEAIRFAGEQLVKGGYVEPEYVQAMLDREKLTPTYLGESIAVPHGTVEAKDRVLKTGVVFCQ YPEGVRFGEEEDDIARLVIGIAARNNEHIQVITSLTNALDDESVIERLAHTTSVDEVLELLAGRK

MI_LRS Download
i j MI MI_LRS
961290.332440.1372
251000.30260.085397
53900.461020.072886
15240.392560.068903
46520.460240.067674
23400.294040.06726
26400.316820.067176
25790.287450.065627
18870.373680.063117
431000.261720.052934
10280.35010.047024
13790.286480.045311
84960.210140.043798
791000.233280.037268
11800.257760.0332
12800.270440.032737
63710.270450.032537
36720.237720.028566
1221350.22740.02851
751020.293680.028154
91340.290050.027328
751080.27250.025133
22430.208320.02323
15790.237590.020183
10240.303790.020139
14820.210270.02006
52610.258610.019496
481270.205580.019206
261000.210470.018768
51640.295510.018761
501160.268980.018642
50570.262640.01832
66990.13210.017054
31410.193820.016635
1161250.248130.016055
42650.242070.015898
601010.13190.015575
26430.239550.015539
741040.270990.014951
17430.149180.014824
761030.197360.014814
15210.264920.014336
58890.13870.0142
541120.199480.014192
91370.197450.014043
38750.221030.013747
641160.317070.013532
43980.121990.013402
951300.126230.013091
38700.260580.012826
80970.211730.012777
53890.334930.012755
42630.238450.012528
1031300.211150.012371
1181240.257130.012359
971290.194960.012326
25770.231950.011862
21790.211090.011771
21450.0983860.011643
56700.30840.011463
11450.0988640.011127
1311400.287610.011083
1101180.211250.01027
7490.172730.010239
511320.161340.010232
25370.188520.010193
761110.146750.0099754
291020.201370.0096095
29770.16050.0095505
31450.0942550.0089428
81040.24510.0084135
21610.168960.0081805
1071410.132080.007954
14350.233310.0078756
78970.155280.0074719
61350.164130.0072184
68740.212920.0071933
491230.182710.0070787
951440.0631850.0067493
841310.170030.0067265
401140.215030.0066394
76990.119140.0066065
961030.232380.0065436
391020.28320.0064816
50960.202980.0063975
4670.127210.0063454
19440.204580.006248
25670.139170.0058033
801290.236790.0055689
32980.118840.005478
931120.228480.0053375
121200.234170.0052134
37720.20040.005203
561430.150740.004987
25530.312740.0049324
47820.132910.0048098
671450.0335210.0047133
56930.286680.0043463
19270.221980.0043366
781170.132180.0043279
821230.155960.0042685
41520.176950.0042444
81950.140960.0042374
22520.219860.0041472
7680.155380.0040186
231160.158620.0039803
42700.247970.0037454
13880.228030.0036861
651310.232880.0034635
38520.181220.0032741
781300.130850.0032159
531270.209910.0031875
23440.208310.0030862
1031420.212460.0030572
68820.155790.00298
961190.140320.0029231
141350.181720.0028277
771130.19560.0027656
271430.124160.0026501
57960.208040.0026346
64920.284560.0025579
72970.165410.0025511
7170.186340.0024376
18470.372420.002368
781370.137470.0023493
41650.195490.0022482
1021280.145720.0021815
1331410.188530.0021745
18880.268070.0021738
81390.186780.0021693
62780.0819510.0018974
53590.202240.0018647
76870.175970.0018153
1111220.186130.0017221
6990.106030.0016161
371030.189760.0015911
1071200.224530.0014543
1301390.220340.0014416
20980.100860.0014394
311320.176680.0013112
281080.246170.0012417
481400.174890.0011946
111090.172410.0011834
28770.252410.0011637
51730.167590.001158
COV_LRS Download
i j COV COV_LRS
961290.616440.16032
25790.612430.10386
251000.606880.10012
46520.663680.096599
53900.762760.093432
261000.499110.079761
11800.530790.078417
12800.539130.073476
26400.570850.069262
23400.535540.064937
15240.665430.06478
84960.44560.063901
66990.354580.056682
14820.475450.053753
36720.518320.052845
13790.570620.051193
791000.533970.050694
50570.509350.048429
751020.569860.047466
601010.313950.046886
751080.558510.046767
10280.640640.044556
18870.64850.044364
21980.340130.044223
42630.520320.041358
1311400.518120.037534
53890.636820.035062
63710.522320.033387
34730.511130.033155
15210.51130.03222
1181240.490650.029283
40750.525170.029228
21790.480810.028948
1031420.458520.028632
781300.339160.028498
741270.431490.028196
31410.396570.028039
81950.31150.027276
81960.428020.025099
11450.0877040.025065
42700.534140.024776
23440.441670.024224
21450.0876080.024111
31450.0873210.023359
711020.503350.022579
321170.454960.022019
76870.39690.021474
431000.5040.021142
22430.44340.020957
58890.339640.020861
81390.446070.020618
51430.30540.020354
801290.493020.019491
531270.435180.018726
391020.562760.018644
31380.402250.018491
491230.410820.018095
951300.271090.01777
1161250.48550.017319
631360.346890.017293
55630.49720.017273
511170.43590.016804
541120.413130.01636
101270.453490.01605
1061130.459920.014857
29350.449170.014531
64980.39210.013316
121200.510550.012986
36580.296180.012449
521110.350780.012416
4670.353070.01235
201360.321940.011868
15790.495210.011826
44820.365690.011661
961030.434380.011538
761030.426710.011336
1331410.325950.011258
31440.0831570.011223
91370.446810.011082
28970.379460.011001
291300.268410.010934
42650.520110.010912
19480.417750.010678
68820.315220.010431
45960.387850.010334
19270.401630.010331
31890.390870.010203
52610.396910.010132
27550.371110.0097321
481270.4270.0096647
21440.0838990.009651
7170.384620.0093429
50790.454760.0093162
231110.370650.0090354
57830.36250.0089589
11440.0841290.008574
20990.245880.0084113
86940.556180.0083894
22940.304880.0079372
57980.327190.0078631
35980.262380.0078169
631140.456190.0076683
281080.531330.0076087
221020.379650.0074267
851100.282760.0069949
8340.538450.0069031
72970.362750.0065487
571290.433180.0065018
37720.448670.0064572
641260.421080.006452
621410.0964940.0058338
951440.084880.0054463
17930.343730.0054064
71270.381930.0053186
371030.429580.0051635
14580.304610.0051386
871010.343220.0051114
241120.33080.004735
1071200.467730.0046665
59950.194960.0046272
121390.435310.0046221
76990.292350.0045658
32970.358440.0045116
1351410.381010.0044825
33860.36970.0044759
47590.288920.0043236
481020.346490.0043006
991180.277330.0042456
61350.399880.0041889
461180.265490.0041374
61930.240260.0040426
131150.27510.0040385
26920.448040.0039846
1001250.352120.0039518
811080.362010.0039188
39460.520930.0038747
38700.523160.003852
901320.434260.0037987
32440.420810.0037144
41650.444610.0036851
67990.229090.0036681
87980.382330.003555
651010.349980.0035537
10240.587640.0035
241240.435340.0034137
OMES_LRS Download
i j OMES OMES_LRS
465229.1876.6922
539114.0754.7417
711028.18313.8742
961295.72963.8604
539010.1653.7214
601016.08063.1973
251008.5493.1463
22438.94023.1265
188719.8462.8162
13795.84432.6986
4678.93262.5589
25797.86632.4135
431008.25592.2816
11805.05892.2266
26404.93522.194
21984.37762.1843
91378.62932.1265
25778.31762.0558
84964.36312.0429
526013.4461.9501
791006.08911.9408
261005.19571.8998
531129.32511.763
14823.52411.7315
8711214.6911.6637
221025.05291.6632
12804.13731.5239
22404.62851.4435
410814.5141.431
34733.42911.3965
50574.33461.3641
751025.191.3336
526111.0531.2966
66993.52721.2023
21796.27611.1934
15244.77881.1435
53929.95771.1212
291025.97611.1207
34763.49391.119
1311404.0841.0785
25438.35271.0683
15215.77941.0615
691043.67491.0584
23402.94121.0532
53607.3641.0446
81953.10991.0229
10244.46491.0035
29715.5350.92047
59952.02340.91814
741044.97430.91339
81963.02390.85524
185224.1610.83521
26435.9480.81889
63715.83470.77442
1151282.72510.76857
1181242.74760.73277
184623.3010.72261
9211210.790.65642
441052.96720.64076
213912.1960.63025
551164.32820.62442
53896.34910.61797
1081243.93560.6168
60763.84670.59163
36722.46410.58949
581132.47610.589
91345.84350.57773
18779.70920.56351
911045.88270.5565
15232.87490.54414
10284.27390.52465
931128.72180.50593
1081166.8660.48032
5674.44350.45382
18448.9820.42406
521035.70630.4237
391028.1240.42159
1151311.95440.40956
1121313.4790.38371
55635.03610.38169
21704.7630.35735
68821.85560.34744
21296.45830.33821
751084.8730.33505
971251.98140.33165
46617.82890.33038
26333.18710.32938
821191.99230.32782
47594.83420.32712
1211282.13730.32622
571292.06270.31652
61352.37850.29913
39657.29520.295
19481.68670.27174
1221351.84210.2569
56934.10940.25653
341092.24790.25197
831221.56320.24549
711375.30610.24242
518712.5180.22535
351084.53970.2192
35792.71460.20501
52663.65910.20004
901432.10190.19219
501125.98860.19139
121361.97560.18817
911402.92340.18016
57962.16740.17958
23442.05910.17759
20811.73090.17613
1101381.56710.16836
80943.43740.16519
641165.20680.16082
321171.59270.15697
57914.60340.15655
28703.45190.156
651133.85530.15546
21853.61230.1478
64982.69830.1449
59991.68880.14115
20991.87650.13969
29774.40620.13955
65934.56660.13817
1331413.73590.13173
5333.59230.13018
58891.88420.12792
151032.45270.12132
361231.24020.12052
42634.61390.11822
111281.71640.1148
57944.6610.11314
231111.12590.10912
901052.12120.10826
1061131.57690.10771
1281373.40710.10598
11333.58710.096573
451391.42010.095763
901011.81180.094697
1061151.37220.093058
184720.1470.09195
51431.93970.090088
61088.81120.089975
851181.74530.086176
561221.37910.085012
971291.58370.084264